KEGG   Bubalus bubalis (water buffalo): 102390843
Entry
102390843         CDS       T05912                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04014  Ras signaling pathway
bbub04390  Hippo signaling pathway
bbub04392  Hippo signaling pathway - multiple species
bbub05200  Pathways in cancer
bbub05206  MicroRNAs in cancer
bbub05219  Bladder cancer
bbub05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102390843 (RASSF1)
   04390 Hippo signaling pathway
    102390843 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102390843 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102390843 (RASSF1)
   05206 MicroRNAs in cancer
    102390843 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102390843 (RASSF1)
   05223 Non-small cell lung cancer
    102390843 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH
Other DBs
NCBI-GeneID: 102390843
NCBI-ProteinID: XP_006053372
LinkDB
Position
21
AA seq 370 aa
MRTSSLVSLGRRGLREGADLRAEIILGGEACVTPPFDSLPPMRRQLDPGCLRFSVNGCGA
DTGSGARTLIYGRARVHALGAVVGVYRCTGAGGLAGVAMGEADAGTPSFEMTWNSTTSSG
YCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETPDLSQAEIEQKIKEYNGQINSNL
FMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTAVKRRTSFYLPKDA
VKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLSDDEQPLRLRL
LAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKI
QEALHACPLG
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcgcacaagctccttagtgtcccttgggaggcggggcctgcgagaaggcgctgatctg
agggctgagatcattcttggaggcgaggcgtgtgtgaccccgcccttcgacagccttcct
ccaatgagacgacagctagatcctggctgtctacgtttcagtgttaacggttgcggcgcg
gacactggttccggcgcacgcacactcatatacgggcgcgcacgcgtacacgcgcttggg
gcggtggtgggagtctaccggtgcaccggagctggcgggctggcgggcgtggcgatgggt
gaggcggacgcgggaacgccttccttcgagatgacttggaacagcacgacaagcagtggc
tactgcagccaggaggactcggactcagagctcgagcagtacttcactgcgcgtacctcg
ctggcgcgcaggccgcgtcgggaccaggatgagcccgtggagtgggagacacctgacctt
tctcaagctgagatcgagcagaagatcaaggagtacaatggccagatcaacagcaacttg
ttcatgagcctgaacaaggatggctcctacacaggcttcatcaaggttcaactgaagctg
gtgcgccctgtctcagttccctccagcaagaaaccaccctccctgcaggatgcccggcga
ggcccagggcggggcacagctgtgaaacgccgcacctccttctacctgcccaaggatgct
gtcaagcacctgcacgtgttgtcacgcacgcgggcacgtgaggtcatcgaggccctgttg
cgcaaattcctggtggtggatgaccctcgcaagtttgcactctttgagcgggctgagcgc
catggccaagtgtacctccggaagctgtccgatgatgagcagcccctacgcctccggctc
cttgcagggcccagtgagaaggccctaagctttgtgctgaaggagaatgactctggggag
gtgaattgggacgctttcagcatgcctgagctacacaactttctgcgcatcttgcagcgg
gaggaagaggaacacctccgccagatcctgcagaagtactcctattgtcgccagaagatc
caggaagccctgcacgcctgccccctggggtga

DBGET integrated database retrieval system