KEGG   Bubalus bubalis (water buffalo): 102390878Help
Entry
102390878         CDS       T05912                                 

Gene name
PRKAB1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04371  Apelin signaling pathway
bbub04530  Tight junction
bbub04710  Circadian rhythm
bbub04714  Thermogenesis
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102390878 (PRKAB1)
   04068 FoxO signaling pathway
    102390878 (PRKAB1)
   04152 AMPK signaling pathway
    102390878 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102390878 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102390878 (PRKAB1)
   04922 Glucagon signaling pathway
    102390878 (PRKAB1)
   04920 Adipocytokine signaling pathway
    102390878 (PRKAB1)
   04921 Oxytocin signaling pathway
    102390878 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    102390878 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    102390878 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102390878 (PRKAB1)
   04714 Thermogenesis
    102390878 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102390878 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102390878 (PRKAB1)
   04931 Insulin resistance
    102390878 (PRKAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 102390878
NCBI-ProteinID: XP_025123407
LinkDB All DBs
Position
17
AA seq 270 aa AA seqDB search
MGNTSSERAALDRQGGHKTPRRDSSGGSKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPVVTSQLGTVNNVIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacgagcagcgagcgcgctgcgctggaccggcagggcggccacaagacaccc
cgaagggacagctccgggggctccaaggatggagacaggcccaagatcctgatggacagc
cccgaagacgccgacctctttcactctgaggaaatcaaggctccagagaaggaggagttc
ctggcctggcagcacgatctggaagtgaacgacaaagctcccgcccaggctcggccaact
gtttttcgatggacggggggtggaaaggaagtttacttgtctgggtcctttaacaactgg
agtaaacttcccctcacaagaagccacaataactttgtagccatcctggatctgccggaa
ggagagcatcagtacaagttctttgtggatggtcagtggacacacgacccttccgagcca
gtagtcaccagccagcttggtacagtcaacaacgtcattcaggtgaagaaaactgacttt
gaagtgtttgatgctttaatggtggattcccaaaagtgctccgacgtgtctgagttgtct
agttccccgccgggaccctaccatcaggagccctatatctcaaaaccagaggagcggttt
aaagcgcctcccatcctcccaccacatctcctccaagtcatcctaaacaaggacacgggc
atttcttgtgatccagctttgctccctgagcccaaccacgtcatgttgaaccacctctat
gcgctctccatcaaggatggagtgatggtgctcagcgcgacccaccggtacaagaaaaaa
tacgtcaccaccttgttatacaaacccatatga

KEGG   Bubalus bubalis (water buffalo): 102402324Help
Entry
102402324         CDS       T05912                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04371  Apelin signaling pathway
bbub04530  Tight junction
bbub04710  Circadian rhythm
bbub04714  Thermogenesis
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub05410  Hypertrophic cardiomyopathy (HCM)
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102402324 (PRKAA2)
   04068 FoxO signaling pathway
    102402324 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    102402324 (PRKAA2)
   04152 AMPK signaling pathway
    102402324 (PRKAA2)
   04150 mTOR signaling pathway
    102402324 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102402324 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102402324 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102402324 (PRKAA2)
   04922 Glucagon signaling pathway
    102402324 (PRKAA2)
   04920 Adipocytokine signaling pathway
    102402324 (PRKAA2)
   04921 Oxytocin signaling pathway
    102402324 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    102402324 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    102402324 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102402324 (PRKAA2)
   04714 Thermogenesis
    102402324 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102402324 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    102402324 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102402324 (PRKAA2)
   04931 Insulin resistance
    102402324 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102402324 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102402324 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:bbub03029]
    102402324 (PRKAA2)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102402324 (PRKAA2)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102402324 (PRKAA2)
Membrane trafficking [BR:bbub04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102402324 (PRKAA2)
Mitochondrial biogenesis [BR:bbub03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102402324 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    102402324 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 102402324
NCBI-ProteinID: XP_006048325
LinkDB All DBs
Position
6
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAQMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSTMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRRNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSLDSVTAEGHSLSGSLTGSLTGSMSSSVSPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggccactacgtgctgggcgac
acgctgggcgtcggcaccttcggcaaagtgaagattggagagcatcaattgacaggccat
aaagtggcagttaaaattttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactctttcgtcatcctcatattatcaaactatac
caggtgatcagcactccaacagatttttttatggtaatggaatatgtgtctggtggtgaa
ctgtttgactacatctgtaaacatggacgggttgaagagatggaagctcggcggctcttt
cagcagattctgtctgccgtggattactgtcataggcacatggttgttcatcgagacctg
aaaccagagaatgtgctattggacgcacagatgaatgccaagatagctgattttggatta
tctaacatgatgtcagatggtgaatttctgcgaactagctgcggatccccaaattatgca
gcacctgaagtcatctcaggcaggctgtatgcaggtcctgaagtggatatctggagctgc
ggtgttattttgtatgctcttctttgtggcaccctcccatttgatgatgagcatgtgcct
acgctgtttaagaagatccgagggggtgttttttacatcccagaatatctcaatcgttct
gttgctactctcctgatgcatatgctgcaggttgatcccctgaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaactggttcttttatggatgatagtaccatgcatattccc
ccaggcctgaaacctcatccggaaaggatgccacctcttatagcagacagccctaaagca
cgatgtccactggatgcactgaatacaacgaagcccaaatctttagctgtgaagaaagcc
aagtggcatcttggaatccgaagtcaaagcaaaccatatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatctacgtgta
agaagaagaaatccagtgactggcaattatgtgaaaatgagcttacagctgtacctggtt
gacaacagaagctatcttttggactttaaaagcattgatgatgaggtggtggagcagagg
tctggttcctcaacacctcagcggtcctgttctgctgctggcttacacagaccacggtcc
agtttggattctgtaactgcggagggccattcactctctggctctctcacgggctctttg
accggaagcatgtcgtcctctgtctcacctcgcctgggcagtcacaccatggattttttt
gaaatgtgtgccagtctgatcactactttagcacgctga

KEGG   Bubalus bubalis (water buffalo): 102403101Help
Entry
102403101         CDS       T05912                                 

Gene name
PRKAG1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04371  Apelin signaling pathway
bbub04530  Tight junction
bbub04710  Circadian rhythm
bbub04714  Thermogenesis
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102403101 (PRKAG1)
   04068 FoxO signaling pathway
    102403101 (PRKAG1)
   04152 AMPK signaling pathway
    102403101 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102403101 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102403101 (PRKAG1)
   04922 Glucagon signaling pathway
    102403101 (PRKAG1)
   04920 Adipocytokine signaling pathway
    102403101 (PRKAG1)
   04921 Oxytocin signaling pathway
    102403101 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    102403101 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    102403101 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102403101 (PRKAG1)
   04714 Thermogenesis
    102403101 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102403101 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102403101 (PRKAG1)
   04931 Insulin resistance
    102403101 (PRKAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3 DRTGG DUF2497
Motif
Other DBs
NCBI-GeneID: 102403101
NCBI-ProteinID: XP_006054607
LinkDB All DBs
Position
4
AA seq 330 aa AA seqDB search
MEAVPSSDSYPAVENEHLQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggtcccttcttcagatagctacccagctgtggaaaatgagcatcttcaagag
actccggaatctaacaatagcgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagctcaaaactggttgtatttgatacttcccttcaggtgaagaaagct
ttctttgctttggtgactaatggtgtccgggcggcccctttgtgggatagtaagaagcag
agttttgtgggcatgctgaccatcactgatttcatcaatatcctgcaccgctactataaa
tcagccttggtgcagatctatgagctggaagaacacaagatagaaacttggagagaggtg
tatctacaggactcctttaaaccacttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcgaaacaagatccacaggctgccagttattgacccggaatca
ggcaacaccttgtacatcctcacccacaagcgtatcctcaagttcctcaagttatttatc
accgagttccccaagccagagttcatgtctaagtctctggaagagctacagattggcacc
tatgccaacattgctatggtccgcaccaccacccctgtgtacgtggctctgggcatcttt
gtacagcaccgagtctcagccctgccagtggtggatgagaaagggcgtgtggtggacatc
tactccaagtttgatgttatcaacctggcagcagaaaagacctacaacaacctagatgtg
tcagtgaccaaagccctgcaacatcgatcacattactttgagggtgttctcaagtgctac
ctgcatgagactctggaaaccatcatcaataggctggtagaagcagaggttcaccgactt
gtagtggtggatgagaatgatgtggtcaaggggattgtatccctatctgacatcttgcag
gcgctggtgctcacaggcggagagaagccctga

KEGG   Bubalus bubalis (water buffalo): 102404085Help
Entry
102404085         CDS       T05912                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04371  Apelin signaling pathway
bbub04530  Tight junction
bbub04710  Circadian rhythm
bbub04714  Thermogenesis
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub05410  Hypertrophic cardiomyopathy (HCM)
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102404085 (PRKAA1)
   04068 FoxO signaling pathway
    102404085 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    102404085 (PRKAA1)
   04152 AMPK signaling pathway
    102404085 (PRKAA1)
   04150 mTOR signaling pathway
    102404085 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102404085 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102404085 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102404085 (PRKAA1)
   04922 Glucagon signaling pathway
    102404085 (PRKAA1)
   04920 Adipocytokine signaling pathway
    102404085 (PRKAA1)
   04921 Oxytocin signaling pathway
    102404085 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    102404085 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    102404085 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102404085 (PRKAA1)
   04714 Thermogenesis
    102404085 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102404085 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    102404085 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102404085 (PRKAA1)
   04931 Insulin resistance
    102404085 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102404085 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102404085 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:bbub03029]
    102404085 (PRKAA1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102404085 (PRKAA1)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102404085 (PRKAA1)
Membrane trafficking [BR:bbub04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102404085 (PRKAA1)
Mitochondrial biogenesis [BR:bbub03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102404085 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    102404085 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102404085
NCBI-ProteinID: XP_006053899
LinkDB All DBs
Position
19
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRACQRNDSDAEAQGKSSEASLTSSVTSLDSSPVELTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacgga
cgggtgaagatcggtcactacatcctgggggatacgctgggggtcgggaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagttgctgtgaagatactgaatcgg
cagaagattcgaagccttgatgtagtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggctggatgaaaaagaaagtcgacgactgttccaacaaatcctttctggtgtggattac
tgtcacaggcatatggtggtccacagagatttgaaacctgaaaacgtcctgcttgatgca
cacatgaatgcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgctgcaccagaagtaatttcaggaagattg
tatgctggtccagaggtagatatatggagcagtggggttattctgtatgctttattatgt
ggaacccttccgtttgatgatgatcacgtgccaactctttttaagaagatatgtgatggg
atcttttatacccctcaatatttaaatccttctgtgattagccttttgaaacatatgctg
caggtggatcccatgaagagagccacaatcaaagatatcagggaacatgaatggtttaaa
caggaccttccaaaatatctctttcctgaggatccatcatatagctcaaccatgattgat
gatgaagccttaaaagaagtatgtgaaaaatttgaatgctcagaggaggaggttctcagc
tgcctttataacagaaatcaccaggaccctttggcagttgcctaccaccttataatagat
aacaggaggataatgaacgaggccaaagatttttacttggcaacaagcccaccagattca
tttctcgacgatcaccacttgacccggccccatcctgaaagagtaccattcttggttgct
gaaactcccagggcgcgccataccctcgatgaattaaatccacagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttgggaattagaagtcaaagtcggccaaatgatatc
atggcagaagtttgtagagcaattaaacaactggattatgaatggaaggttgtaaacccg
tattatttgcgtgttcggaggaagaatcctgtgacaagtacatactccaaaatgagtctg
cagttataccaagtggatagtagaacgtatttattggatttccgaagtattgatgatgaa
attactgaagccaaatcagggactgctacgccacagagatcgggctcagttagcaactat
cgagcttgccaaaggaatgattcagatgctgaggctcaaggaaaatcctcagaagcttct
cttacctcatctgtaacctcacttgactcttctcctgttgaattaactccaagacctgga
agtcacacaatagaattttttgagatgtgcgcgaatctaattaaaattcttgcacagtaa

KEGG   Bubalus bubalis (water buffalo): 102407334Help
Entry
102407334         CDS       T05912                                 

Gene name
PRKAG3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04371  Apelin signaling pathway
bbub04530  Tight junction
bbub04710  Circadian rhythm
bbub04714  Thermogenesis
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102407334 (PRKAG3)
   04068 FoxO signaling pathway
    102407334 (PRKAG3)
   04152 AMPK signaling pathway
    102407334 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102407334 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102407334 (PRKAG3)
   04922 Glucagon signaling pathway
    102407334 (PRKAG3)
   04920 Adipocytokine signaling pathway
    102407334 (PRKAG3)
   04921 Oxytocin signaling pathway
    102407334 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    102407334 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    102407334 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102407334 (PRKAG3)
   04714 Thermogenesis
    102407334 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102407334 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102407334 (PRKAG3)
   04931 Insulin resistance
    102407334 (PRKAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 102407334
NCBI-ProteinID: XP_006059080
LinkDB All DBs
Position
2
AA seq 563 aa AA seqDB search
MTQQDPSLPSSDTQEADRTGHQDSMCAPPLTSPAAPRLQGWSRSTGGPLPPQCLTPNQRE
PDPGGQGARGRAQNSAAQIQCCALAHGARRAGARAVREMSFLEQGDSTSWPSPAMTTSTE
ISLGEQRTKVSRWKSQEDVEERELPGLEGGPQSRPAAESTGLEATFPKATPLAQATPLSA
VGTPTTERDSLPADCTASASSSSTDDLDLGIEFSAPAAWGDELGLVEERPAQCPSPQVPV
LRLGWDDELRKPGAQVYMHFMQEHTCYDAMATSSKLVIFDTMLQIKKAFFALVANGVRAA
PLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEIEEHKIETWREIYLQGCFKPLVSI
SPSDSLFEAVYTLIKNRIHRLPVLDPVSGAVLHILTHKRLLKFLHIFQRTLLPRPSFLSR
TIQDLGIGTFRDLAVVLETAPILNALDIFVDRRVSALPVINEAGQVVGLYSRFDVIHLAA
QQTYNHLDISVGEALRRRTLCLEGVLSCQPHETLGEVIDRIAREQVHRLVLVDETQHLLG
VVSLSDILQALVLSPAGIDALGA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcaggatccttctctcccatcatcggacacccaggaggcagacagaaccggg
catcaagattccatgtgcgcccctcccctcacctccccagcagcccccaggcttcagggc
tggagcagaagcacgggtggaccccttcctccccagtgcctgacacccaatcagagagaa
cccgatccaggagggcagggtgccaggggccgggcccagaatagtgctgcccagatacag
tgttgcgcactcgctcatggagcccgccgagctggagcacgcgctgtgcgggagatgagc
ttcctagagcaaggagacagcacttcatggccatcaccagccatgaccaccagcacagaa
ataagccttggggaacagaggaccaaggtctcaagatggaaaagccaggaggatgtagag
gaaagggagctgccaggcctggagggaggtccccagtccaggccagctgccgagtccacc
gggctggaggccacattccccaaggccacacccttggcccaagccactcccttgtccgca
gtgggcacccccacaacagagcgagacagcctccccgctgattgtacagcctccgcttcc
agctccagcacagacgatctggatctgggcatagagttctcagccccagcagcgtggggg
gatgagcttggcctggtggaagagaggccggcccagtgtccgtccccgcaggtgccggtg
ctcaggctcggctgggacgatgagctgcggaagccaggggcccaggtctacatgcacttc
atgcaggagcacacctgctacgatgccatggcaaccagctccaagctggtcatcttcgac
accatgctacagatcaagaaggccttctttgccctggtggccaacggcgtccgtgccgca
cctctatgggacagcaagaagcagagcttcgtggggatgctgactatcacagacttcatc
ttggttctgcatcgctattaccggtcccccttggtccagatctatgagattgaagaacac
aaaattgagacctggagggagatctaccttcaaggctgctttaagcctctggtctccatc
tctcccagtgacagcctgttcgaagctgtctacaccctcatcaagaaccgtatccaccgc
ctgccggtcctggacccagtctcaggcgccgtgcttcacatcctcacacacaaacggctt
ctcaagttcctgcacatctttcagcgcaccctgctgccccggccctccttcctctcccgc
accatccaagatctgggcatcggcacattccgagacttggccgtggtgctggaaacggca
cccatcctcaacgcgctggacatctttgtggaccggcgcgtgtctgcgctgccggtgatc
aacgaagctggacaggttgtgggcctctactcccgctttgatgtgattcacctggcagcc
caacaaacgtacaaccacctggacataagtgtgggagaagcactgaggcggaggacgctg
tgtctggagggagtcctttcctgccagccccacgagaccttgggggaagtcatcgaccgg
attgcccgggagcaggtgcaccggctggtgcttgtggatgaaacccagcacctcctgggc
gtggtgtccctctctgacatccttcaagctctagtgctcagccccgctggcatcgacgcc
cttggggcctga

KEGG   Bubalus bubalis (water buffalo): 102410053Help
Entry
102410053         CDS       T05912                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform X7
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04371  Apelin signaling pathway
bbub04530  Tight junction
bbub04710  Circadian rhythm
bbub04714  Thermogenesis
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102410053 (PRKAG2)
   04068 FoxO signaling pathway
    102410053 (PRKAG2)
   04152 AMPK signaling pathway
    102410053 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102410053 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102410053 (PRKAG2)
   04922 Glucagon signaling pathway
    102410053 (PRKAG2)
   04920 Adipocytokine signaling pathway
    102410053 (PRKAG2)
   04921 Oxytocin signaling pathway
    102410053 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    102410053 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    102410053 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102410053 (PRKAG2)
   04714 Thermogenesis
    102410053 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102410053 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102410053 (PRKAG2)
   04931 Insulin resistance
    102410053 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3
Motif
Other DBs
NCBI-GeneID: 102410053
NCBI-ProteinID: XP_006077718
LinkDB All DBs
Position
8
AA seq 308 aa AA seqDB search
MRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTIT
DFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVHSLIKNK
IHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDALGIGTYHNIAFIHP
DTPIIKALNVFVERRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHR
SQYFEGVVKCSKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGA
KQKQTEAE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcatgaggtcacacaagtgttacgacatcgttccaaccagctccaagcttgtc
gttttcgataccacgttacaagttaaaaaggccttctttgccttagtcgccaatggtgtt
cgagcagcacctctgtgggagagtaaaaaacaaagttttgtaggaatgctaacaattaca
gatttcattaatatactacatagatactataaatcacccatggtacagatttatgaatta
gaggaacataagattgaaacatggagggagctttatttacaagaaacatttaagccttta
gtgaatatatctccagatgcaagcctcttcgatgctgtgcactcgttgatcaaaaataaa
atccacagattgccagttattgaccccatcagtgggaatgcactttatatacttacccac
aaaagaatcctcaagttcctccagctttttatgtctgatatgccaaagcctgccttcatg
aagcagaacctggacgcacttggaatcgggacctaccataacatcgccttcatacacccg
gacactcccatcattaaagccttgaacgttttcgtggaaagacgagtgtctgccttgcct
gtggtggacgagtcaggaaaagttgtagatatttattccaaatttgatgtaattaacctt
gctgctgaaaaaacgtacaacaacctagacatcacagtgacccaggccctacagcaccgg
tcgcagtatttcgagggcgtagtgaagtgcagtaagctggagatactggagaccatcgtg
gacagaatcgtgagagcggaggtccatcggctggtggtcgtcaatgaagccgatagtatc
gtgggaattatttccctgtccgatattctgcaggccctgatactcacccccgcaggtgcc
aaacagaagcaaacggaagccgagtga

KEGG   Bubalus bubalis (water buffalo): 102412137Help
Entry
102412137         CDS       T05912                                 

Gene name
PRKAB2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04371  Apelin signaling pathway
bbub04530  Tight junction
bbub04710  Circadian rhythm
bbub04714  Thermogenesis
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102412137 (PRKAB2)
   04068 FoxO signaling pathway
    102412137 (PRKAB2)
   04152 AMPK signaling pathway
    102412137 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102412137 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102412137 (PRKAB2)
   04922 Glucagon signaling pathway
    102412137 (PRKAB2)
   04920 Adipocytokine signaling pathway
    102412137 (PRKAB2)
   04921 Oxytocin signaling pathway
    102412137 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    102412137 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    102412137 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102412137 (PRKAB2)
   04714 Thermogenesis
    102412137 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102412137 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102412137 (PRKAB2)
   04931 Insulin resistance
    102412137 (PRKAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 102412137
NCBI-ProteinID: XP_006075900
LinkDB All DBs
Position
6
AA seq 272 aa AA seqDB search
MGNTTSDRVAGERHGAKAARAEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacaaccagcgatcgagtggccggggagcgccacggcgccaaggctgcgcgc
gccgagggcgccggcggccatgctccgggtaaggaacataagatcatggtggggagcacc
gacgaccccagcgtcttcagcctgccggactccaagctccctggggacaaagagtttgta
tcatggcagcaggatttggaggactccgtaaagcccacacagcaggcccggcccactgtt
atccgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagc
accaagattccactgattaagagccataatgactttgttgccatcctggacctccctgag
ggagagcaccagtacaagttttttgtggatggacagtgggttcatgatccatcagagcct
gtggttaccagtcagcttggcacaattaacaatttgatccatgtcaagaaatctgatttt
gaggtgtttgatgctttaaagctagattcaatggaaagctcagagacatcttgtcgagac
ctttccagctcacccccagggccttatggtcaagaaatgtatgtgtttcgatcagaggag
agatttaaatccccacccatcctgcctcctcaccttctccaagttattcttaacaaggac
actaacatatcttgtgacccagccttgctccccgagcccaatcatgttatgctgaaccat
ctctatgcattgtccattaaggacagtgtgatggtccttagtgcaacccatcgctacaag
aagaagtatgtcactactcttctgtacaagcccatctga

DBGET integrated database retrieval system