KEGG   Bubalus bubalis (water buffalo): 102391004
Entry
102391004         CDS       T05912                                 

Gene name
LDLR
Definition
(RefSeq) low-density lipoprotein receptor isoform X1
  KO
K12473  low-density lipoprotein receptor
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04144  Endocytosis
bbub04913  Ovarian steroidogenesis
bbub04925  Aldosterone synthesis and secretion
bbub04927  Cortisol synthesis and secretion
bbub04934  Cushing syndrome
bbub04976  Bile secretion
bbub04979  Cholesterol metabolism
bbub05145  Toxoplasmosis
bbub05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102391004 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    102391004 (LDLR)
   04925 Aldosterone synthesis and secretion
    102391004 (LDLR)
   04927 Cortisol synthesis and secretion
    102391004 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    102391004 (LDLR)
   04979 Cholesterol metabolism
    102391004 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102391004 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102391004 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102391004 (LDLR)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    102391004 (LDLR)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL EGF hEGF
Other DBs
NCBI-GeneID: 102391004
NCBI-ProteinID: XP_025149277
LinkDB
Position
9
AA seq 845 aa
MRLAGWGLRWAIALLIAAGEAAAEDNCGRNEFQCRDGKCISYKWVCDGTAECQDGSDESQ
ETCKSVTCKMGDFSCGGRVNRCISGSWRCDGQVDCENGSDEEGCSPKTCSQDEFRCNDGK
CIAPKFVCDLDLDCLDGSDEASCPTPTCGPANFQCNSSMCIPQLWACDGDPDCDDGSDEW
PKHCGTPRPSGPLQDNNPCSALEFHCGSGECIHSSWHCDHDPDCKDKSDEENCAVATCRP
DEFQCSDGTCIHGSRQCDREPDCKDLSDELGCVNVTLCEGPNKFKCQSGECISLDKVCNS
VRDCRDWSDEPLKDCGTNECLDNKGGCSHICNDLKIGYECLCPEGFQLVGKHRCEDIDEC
QNPDTCSQLCVNLEGSYKCECEEGFRLEPLTKACKAVGTIAYLFFTNRHEVRKMTLDRSE
YTSLIPNLKNVVALDTEVASNRIYWSDLSQRKIYSAQIDGAPGFSSYDTVIGEDLQAPDG
LAVDWIHSNIYWTDSILGTVSVADTKGVKRKTLFQEEGSKPRAIVVDPVHGFMYWTDWGT
PAEIKKGGLNGVDVYSLVTEDIQWPNGITLDLSGGRLYWVDSKLHSISSIDVNGGNRKTV
LEDKKKLAHPFSLAIFEDKVFWTDVINEAIFSANRLTGSDISLMAENLLSPEDIVLFHNL
TQPRGVNWCERTALRNGGCQYLCLPAPQINPRSPKFTCACPDGMLLAKDMRSCLTESESA
VTTRGPSTVSSTAVGPKRTASPELTTAESVTMSQQGLGNIAGRADTERPGSVGALYIVLP
IALLILLAFGTFLLWKNWRLKSINSINFDNPVYQKTTEDEVHICRSQDGYTYPSRQMVSL
EDDVA
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgaggctcgcgggctggggactgcgctgggccatcgccctgctcatcgctgcgggggag
gctgcagcggaagacaactgtgggagaaacgagtttcagtgccgagatgggaaatgcatc
tcctataagtgggtttgtgatgggaccgccgagtgccaagacggctctgatgaatcccag
gagacgtgcaagtctgtcacctgcaagatgggggacttcagctgtgggggccgtgtcaac
cgctgcatttcggggtcctggagatgcgatggccaggtggactgcgagaatggctcggac
gaagaaggctgttcccccaagacgtgctcccaggatgagttccgctgcaatgacggcaag
tgcattgccccgaagttcgtctgtgacttggacctggactgcttagatggctcagatgag
gcgtcctgccccacgcccacctgcggccctgccaacttccagtgcaacagctccatgtgc
atcccccagctctgggcctgcgacggcgaccctgactgcgacgatggctcagacgagtgg
ccgaagcactgcgggaccccccgcccatcaggccccctgcaggacaacaacccctgctcg
gccctcgagttccactgcggcagtggcgagtgcatccactccagctggcattgcgaccat
gaccctgactgcaaggacaagtctgacgaggagaactgcgctgtggccacgtgccggcct
gatgaattccagtgctcggatgggacctgcatccatggtagccggcagtgcgacagggag
cctgactgtaaggatctgagtgacgagctgggctgcgtcaacgtgactctttgcgagggg
cccaacaagttcaagtgccaaagcggtgagtgcatctccctggacaaagtgtgcaactcc
gtcagggactgccgggactggtcggacgagcccctcaaggactgtgggaccaacgaatgt
ctggacaacaagggcggctgctctcacatctgcaatgacctcaagatcggctacgagtgc
ctgtgtcccgaaggcttccagctagtgggcaagcacagatgtgaagatatcgatgagtgt
cagaaccctgacacctgcagccagctctgcgtgaacctagagggcagctacaaatgcgag
tgcgaagagggcttccggctggagcccctcaccaaggcctgcaaggctgtgggcaccatc
gcctacctcttcttcaccaaccgccacgaagtcaggaagatgactctggaccgaagcgag
tacaccagccttatccccaaccttaagaacgtggtcgccctggacacagaggtggccagt
aacaggatctactggtctgacctgtcccagaggaagatctacagtgcccagatcgacgga
gcccccggcttctcctcctacgacaccgtcattggcgaggatctccaggcccccgacggg
ctggcggtggattggatccacagcaacatctactggaccgactccatcctaggcaccgtc
tccgtggctgacaccaaaggcgtgaagaggaagacgctcttccaggaggaaggctccaag
ccacgggccattgtggtggatcccgtccatggcttcatgtattggactgactggggcacc
cctgccgagatcaagaaggggggcctcaacggcgtggacgtttactcgctggtgaccgag
gacatccagtggcccaatggcatcactctagatctttctggcggccgcctctactgggtc
gactccaaactgcactccatctccagcatcgatgtcaatggggggaaccggaagaccgtg
ctggaggacaagaagaagctggcacaccccttctccttggccatctttgaggataaagta
ttttggacggatgttatcaacgaagccatttttagtgccaaccgcctcacaggctcagac
atcagtctgatggcagaaaacctgttatcgccggaggacattgtccttttccacaacctc
acgcagccgagaggggtgaactggtgtgagaggactgccctccgcaatggtggctgccag
tacctgtgtctgccggccccacagatcaacccccgctcacccaagttcacctgtgcctgc
cccgacggcatgctgctggccaaggacatgagaagctgcctcacagagtctgaatctgca
gtgaccacccgaggaccctccacggtcagctcgacagctgtggggccgaagcgcacggcc
agccctgagctcaccacagccgagtcggtgacaatgtcccaacaaggcctgggcaacatt
gccggccgagcggacacggagaggcccgggagcgtgggtgccctatacatcgtcctcccc
atcgcactgctcatcctcctggccttcggaaccttcctcctctggaagaattggcggctg
aagagcatcaacagcatcaacttcgacaaccccgtgtaccagaagaccacggaggacgag
gtccacatctgccgcagccaggacggctacacctacccctcgagacagatggtcagcttg
gaggatgacgtggcgtga

DBGET integrated database retrieval system