KEGG   Bubalus bubalis (water buffalo): 102391021Help
Entry
102391021         CDS       T05912                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  Jak-STAT signaling pathway
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04728  Dopaminergic synapse
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05132  Salmonella infection
bbub05135  Yersinia infection
bbub05142  Chagas disease (American trypanosomiasis)
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102391021 (AKT3)
   04015 Rap1 signaling pathway
    102391021 (AKT3)
   04010 MAPK signaling pathway
    102391021 (AKT3)
   04012 ErbB signaling pathway
    102391021 (AKT3)
   04370 VEGF signaling pathway
    102391021 (AKT3)
   04371 Apelin signaling pathway
    102391021 (AKT3)
   04630 Jak-STAT signaling pathway
    102391021 (AKT3)
   04668 TNF signaling pathway
    102391021 (AKT3)
   04066 HIF-1 signaling pathway
    102391021 (AKT3)
   04068 FoxO signaling pathway
    102391021 (AKT3)
   04072 Phospholipase D signaling pathway
    102391021 (AKT3)
   04071 Sphingolipid signaling pathway
    102391021 (AKT3)
   04024 cAMP signaling pathway
    102391021 (AKT3)
   04022 cGMP-PKG signaling pathway
    102391021 (AKT3)
   04151 PI3K-Akt signaling pathway
    102391021 (AKT3)
   04152 AMPK signaling pathway
    102391021 (AKT3)
   04150 mTOR signaling pathway
    102391021 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102391021 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102391021 (AKT3)
   04218 Cellular senescence
    102391021 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102391021 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102391021 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102391021 (AKT3)
   04620 Toll-like receptor signaling pathway
    102391021 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102391021 (AKT3)
   04660 T cell receptor signaling pathway
    102391021 (AKT3)
   04662 B cell receptor signaling pathway
    102391021 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102391021 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102391021 (AKT3)
   04062 Chemokine signaling pathway
    102391021 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102391021 (AKT3)
   04922 Glucagon signaling pathway
    102391021 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102391021 (AKT3)
   04920 Adipocytokine signaling pathway
    102391021 (AKT3)
   04929 GnRH secretion
    102391021 (AKT3)
   04915 Estrogen signaling pathway
    102391021 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102391021 (AKT3)
   04917 Prolactin signaling pathway
    102391021 (AKT3)
   04926 Relaxin signaling pathway
    102391021 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102391021 (AKT3)
   04919 Thyroid hormone signaling pathway
    102391021 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102391021 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102391021 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102391021 (AKT3)
   04728 Dopaminergic synapse
    102391021 (AKT3)
   04722 Neurotrophin signaling pathway
    102391021 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102391021 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102391021 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102391021 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102391021 (AKT3)
   05205 Proteoglycans in cancer
    102391021 (AKT3)
   05230 Central carbon metabolism in cancer
    102391021 (AKT3)
   05231 Choline metabolism in cancer
    102391021 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102391021 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102391021 (AKT3)
   05212 Pancreatic cancer
    102391021 (AKT3)
   05225 Hepatocellular carcinoma
    102391021 (AKT3)
   05226 Gastric cancer
    102391021 (AKT3)
   05214 Glioma
    102391021 (AKT3)
   05221 Acute myeloid leukemia
    102391021 (AKT3)
   05220 Chronic myeloid leukemia
    102391021 (AKT3)
   05218 Melanoma
    102391021 (AKT3)
   05211 Renal cell carcinoma
    102391021 (AKT3)
   05215 Prostate cancer
    102391021 (AKT3)
   05213 Endometrial cancer
    102391021 (AKT3)
   05224 Breast cancer
    102391021 (AKT3)
   05222 Small cell lung cancer
    102391021 (AKT3)
   05223 Non-small cell lung cancer
    102391021 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102391021 (AKT3)
   05017 Spinocerebellar ataxia
    102391021 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102391021 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102391021 (AKT3)
   04931 Insulin resistance
    102391021 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102391021 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102391021 (AKT3)
   05135 Yersinia infection
    102391021 (AKT3)
   05152 Tuberculosis
    102391021 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102391021 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102391021 (AKT3)
   05162 Measles
    102391021 (AKT3)
   05164 Influenza A
    102391021 (AKT3)
   05161 Hepatitis B
    102391021 (AKT3)
   05160 Hepatitis C
    102391021 (AKT3)
   05168 Herpes simplex virus 1 infection
    102391021 (AKT3)
   05163 Human cytomegalovirus infection
    102391021 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102391021 (AKT3)
   05169 Epstein-Barr virus infection
    102391021 (AKT3)
   05165 Human papillomavirus infection
    102391021 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102391021 (AKT3)
   05142 Chagas disease (American trypanosomiasis)
    102391021 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102391021 (AKT3)
   01524 Platinum drug resistance
    102391021 (AKT3)
   01522 Endocrine resistance
    102391021 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102391021 (AKT3)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102391021 (AKT3)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102391021 (AKT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like FTA2 PH_11 APH
Motif
Other DBs
NCBI-GeneID: 102391021
NCBI-ProteinID: NP_001277903
UniProt: K7WQT1
LinkDB All DBs
Position
5
AA seq 479 aa AA seqDB search
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcacgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacaggctccagaggcaagaagaagagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaag
aaagaagttattattgccaaggatgaagtggcgcatactttaactgaaagcagagtatta
aagaacactagacatccctttttaacatccctgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaatcacagattttggactttgcaaagaagggatcactgatgca
gccaccatgaagactttctgtggtacaccggagtatctggcaccagaggtgttagaagat
aatgactatggccgagctgtggattggtggggccttggggttgtcatgtatgaaatgatg
tgcgggagattacctttctataaccaggatcatgagaaactttttgaactaattctaatg
gaagatattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcaggcctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtgtatgataaaaagcttgtacct
ccttttaagcctcaagtaacgtctgagacagacaccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggacggtatggactgcatg
gacaatgagaggcggccgcacttccctcagttttcctactctgcaagtggacgagaataa

KEGG   Bubalus bubalis (water buffalo): 102397969Help
Entry
102397969         CDS       T05912                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  Jak-STAT signaling pathway
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04728  Dopaminergic synapse
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05132  Salmonella infection
bbub05135  Yersinia infection
bbub05142  Chagas disease (American trypanosomiasis)
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102397969 (AKT1)
   04015 Rap1 signaling pathway
    102397969 (AKT1)
   04010 MAPK signaling pathway
    102397969 (AKT1)
   04012 ErbB signaling pathway
    102397969 (AKT1)
   04370 VEGF signaling pathway
    102397969 (AKT1)
   04371 Apelin signaling pathway
    102397969 (AKT1)
   04630 Jak-STAT signaling pathway
    102397969 (AKT1)
   04668 TNF signaling pathway
    102397969 (AKT1)
   04066 HIF-1 signaling pathway
    102397969 (AKT1)
   04068 FoxO signaling pathway
    102397969 (AKT1)
   04072 Phospholipase D signaling pathway
    102397969 (AKT1)
   04071 Sphingolipid signaling pathway
    102397969 (AKT1)
   04024 cAMP signaling pathway
    102397969 (AKT1)
   04022 cGMP-PKG signaling pathway
    102397969 (AKT1)
   04151 PI3K-Akt signaling pathway
    102397969 (AKT1)
   04152 AMPK signaling pathway
    102397969 (AKT1)
   04150 mTOR signaling pathway
    102397969 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102397969 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    102397969 (AKT1)
   04218 Cellular senescence
    102397969 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102397969 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102397969 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102397969 (AKT1)
   04620 Toll-like receptor signaling pathway
    102397969 (AKT1)
   04625 C-type lectin receptor signaling pathway
    102397969 (AKT1)
   04660 T cell receptor signaling pathway
    102397969 (AKT1)
   04662 B cell receptor signaling pathway
    102397969 (AKT1)
   04664 Fc epsilon RI signaling pathway
    102397969 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    102397969 (AKT1)
   04062 Chemokine signaling pathway
    102397969 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102397969 (AKT1)
   04922 Glucagon signaling pathway
    102397969 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    102397969 (AKT1)
   04920 Adipocytokine signaling pathway
    102397969 (AKT1)
   04929 GnRH secretion
    102397969 (AKT1)
   04915 Estrogen signaling pathway
    102397969 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    102397969 (AKT1)
   04917 Prolactin signaling pathway
    102397969 (AKT1)
   04926 Relaxin signaling pathway
    102397969 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    102397969 (AKT1)
   04919 Thyroid hormone signaling pathway
    102397969 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102397969 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102397969 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    102397969 (AKT1)
   04728 Dopaminergic synapse
    102397969 (AKT1)
   04722 Neurotrophin signaling pathway
    102397969 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102397969 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    102397969 (AKT1)
   04213 Longevity regulating pathway - multiple species
    102397969 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102397969 (AKT1)
   05205 Proteoglycans in cancer
    102397969 (AKT1)
   05230 Central carbon metabolism in cancer
    102397969 (AKT1)
   05231 Choline metabolism in cancer
    102397969 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102397969 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102397969 (AKT1)
   05212 Pancreatic cancer
    102397969 (AKT1)
   05225 Hepatocellular carcinoma
    102397969 (AKT1)
   05226 Gastric cancer
    102397969 (AKT1)
   05214 Glioma
    102397969 (AKT1)
   05221 Acute myeloid leukemia
    102397969 (AKT1)
   05220 Chronic myeloid leukemia
    102397969 (AKT1)
   05218 Melanoma
    102397969 (AKT1)
   05211 Renal cell carcinoma
    102397969 (AKT1)
   05215 Prostate cancer
    102397969 (AKT1)
   05213 Endometrial cancer
    102397969 (AKT1)
   05224 Breast cancer
    102397969 (AKT1)
   05222 Small cell lung cancer
    102397969 (AKT1)
   05223 Non-small cell lung cancer
    102397969 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102397969 (AKT1)
   05017 Spinocerebellar ataxia
    102397969 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102397969 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102397969 (AKT1)
   04931 Insulin resistance
    102397969 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102397969 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102397969 (AKT1)
   05135 Yersinia infection
    102397969 (AKT1)
   05152 Tuberculosis
    102397969 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102397969 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    102397969 (AKT1)
   05162 Measles
    102397969 (AKT1)
   05164 Influenza A
    102397969 (AKT1)
   05161 Hepatitis B
    102397969 (AKT1)
   05160 Hepatitis C
    102397969 (AKT1)
   05168 Herpes simplex virus 1 infection
    102397969 (AKT1)
   05163 Human cytomegalovirus infection
    102397969 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102397969 (AKT1)
   05169 Epstein-Barr virus infection
    102397969 (AKT1)
   05165 Human papillomavirus infection
    102397969 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102397969 (AKT1)
   05142 Chagas disease (American trypanosomiasis)
    102397969 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102397969 (AKT1)
   01524 Platinum drug resistance
    102397969 (AKT1)
   01522 Endocrine resistance
    102397969 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102397969 (AKT1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102397969 (AKT1)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102397969 (AKT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 102397969
NCBI-ProteinID: NP_001277770
UniProt: L7Z988
LinkDB All DBs
Position
20
AA seq 480 aa AA seqDB search
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDLEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPSENSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGVDSERRPHFPQFSYSASGTA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaagcgaggcgagtacatcaag
acgtggcggccgcgttacttcctcctgaagaacgacggcacgttcatcggctacaaggag
cggccgcaggacctggagcagcgcgagtcgcctctcaacaacttctccgtggcccaatgc
cagctgatgaagacggagcggccgcggcccaacaccttcattatccgctgcctgcagtgg
accacggtcatcgagcgcacgttccacgtggagacgcccgaggagcgggaggagtggacc
accgccatccagacggtggccgacgggctcaagaggcaggaggaggagacgatggacttc
cggtcgggctcacccagcgagaactcgggggctgaggagatggaggtgtcgctggccaag
cccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatc
ctgaagaaggaggtcatcgtggccaaggacgaggtggcccacacgctcacagagaaccgc
gttctccagaactcccggcacccgttcctgacggccctgaagtactccttccagacacac
gaccgcctgtgcttcgtcatggagtacgccaacgggggcgagcttttcttccacctgtcc
cgggagcgggtgtttcccgaggaccgggcccgcttctacggcgccgagattgtgtcggcc
ctggattacctgcactcggagaagaacgtggtgtacagggacctcaagctggagaacctc
atgttggacaaggacgggcacatcaagatcaccgacttcggactgtgcaaggagggcatc
aaggacggcgccaccatgaagactttctgcgggacccccgagtacctggcccccgaggtg
ctggaggacaacgactacggccgggcagtggactggtgggggctgggcgtggtcatgtat
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctctttgagctc
attctcatggaggagatccgcttcccccgcacactcagcccggaggccaagtccctgctc
tcggggctgctcaagaaggaccccaagcagcggcttggtgggggctctgaggatgccaag
gagatcatgcagcaccgattcttcgccagcatcgtgtggcaggacgtgtacgagaagaag
ctcagcccgcccttcaagcctcaggtcacatctgagacggacaccaggtattttgatgag
gagttcacggcccagatgatcaccattacgccacctgaccaagacgacagcatggagggg
gtggacagcgaacggaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Bubalus bubalis (water buffalo): 102398761Help
Entry
102398761         CDS       T05912                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  Jak-STAT signaling pathway
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04728  Dopaminergic synapse
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease (NAFLD)
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05132  Salmonella infection
bbub05135  Yersinia infection
bbub05142  Chagas disease (American trypanosomiasis)
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102398761 (AKT2)
   04015 Rap1 signaling pathway
    102398761 (AKT2)
   04010 MAPK signaling pathway
    102398761 (AKT2)
   04012 ErbB signaling pathway
    102398761 (AKT2)
   04370 VEGF signaling pathway
    102398761 (AKT2)
   04371 Apelin signaling pathway
    102398761 (AKT2)
   04630 Jak-STAT signaling pathway
    102398761 (AKT2)
   04668 TNF signaling pathway
    102398761 (AKT2)
   04066 HIF-1 signaling pathway
    102398761 (AKT2)
   04068 FoxO signaling pathway
    102398761 (AKT2)
   04072 Phospholipase D signaling pathway
    102398761 (AKT2)
   04071 Sphingolipid signaling pathway
    102398761 (AKT2)
   04024 cAMP signaling pathway
    102398761 (AKT2)
   04022 cGMP-PKG signaling pathway
    102398761 (AKT2)
   04151 PI3K-Akt signaling pathway
    102398761 (AKT2)
   04152 AMPK signaling pathway
    102398761 (AKT2)
   04150 mTOR signaling pathway
    102398761 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102398761 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    102398761 (AKT2)
   04218 Cellular senescence
    102398761 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102398761 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102398761 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102398761 (AKT2)
   04620 Toll-like receptor signaling pathway
    102398761 (AKT2)
   04625 C-type lectin receptor signaling pathway
    102398761 (AKT2)
   04660 T cell receptor signaling pathway
    102398761 (AKT2)
   04662 B cell receptor signaling pathway
    102398761 (AKT2)
   04664 Fc epsilon RI signaling pathway
    102398761 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    102398761 (AKT2)
   04062 Chemokine signaling pathway
    102398761 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102398761 (AKT2)
   04922 Glucagon signaling pathway
    102398761 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    102398761 (AKT2)
   04920 Adipocytokine signaling pathway
    102398761 (AKT2)
   04929 GnRH secretion
    102398761 (AKT2)
   04915 Estrogen signaling pathway
    102398761 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    102398761 (AKT2)
   04917 Prolactin signaling pathway
    102398761 (AKT2)
   04926 Relaxin signaling pathway
    102398761 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    102398761 (AKT2)
   04919 Thyroid hormone signaling pathway
    102398761 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102398761 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102398761 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    102398761 (AKT2)
   04728 Dopaminergic synapse
    102398761 (AKT2)
   04722 Neurotrophin signaling pathway
    102398761 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102398761 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    102398761 (AKT2)
   04213 Longevity regulating pathway - multiple species
    102398761 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102398761 (AKT2)
   05205 Proteoglycans in cancer
    102398761 (AKT2)
   05230 Central carbon metabolism in cancer
    102398761 (AKT2)
   05231 Choline metabolism in cancer
    102398761 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102398761 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102398761 (AKT2)
   05212 Pancreatic cancer
    102398761 (AKT2)
   05225 Hepatocellular carcinoma
    102398761 (AKT2)
   05226 Gastric cancer
    102398761 (AKT2)
   05214 Glioma
    102398761 (AKT2)
   05221 Acute myeloid leukemia
    102398761 (AKT2)
   05220 Chronic myeloid leukemia
    102398761 (AKT2)
   05218 Melanoma
    102398761 (AKT2)
   05211 Renal cell carcinoma
    102398761 (AKT2)
   05215 Prostate cancer
    102398761 (AKT2)
   05213 Endometrial cancer
    102398761 (AKT2)
   05224 Breast cancer
    102398761 (AKT2)
   05222 Small cell lung cancer
    102398761 (AKT2)
   05223 Non-small cell lung cancer
    102398761 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102398761 (AKT2)
   05017 Spinocerebellar ataxia
    102398761 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102398761 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102398761 (AKT2)
   04931 Insulin resistance
    102398761 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102398761 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102398761 (AKT2)
   05135 Yersinia infection
    102398761 (AKT2)
   05152 Tuberculosis
    102398761 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102398761 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    102398761 (AKT2)
   05162 Measles
    102398761 (AKT2)
   05164 Influenza A
    102398761 (AKT2)
   05161 Hepatitis B
    102398761 (AKT2)
   05160 Hepatitis C
    102398761 (AKT2)
   05168 Herpes simplex virus 1 infection
    102398761 (AKT2)
   05163 Human cytomegalovirus infection
    102398761 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102398761 (AKT2)
   05169 Epstein-Barr virus infection
    102398761 (AKT2)
   05165 Human papillomavirus infection
    102398761 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102398761 (AKT2)
   05142 Chagas disease (American trypanosomiasis)
    102398761 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102398761 (AKT2)
   01524 Platinum drug resistance
    102398761 (AKT2)
   01522 Endocrine resistance
    102398761 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102398761 (AKT2)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102398761 (AKT2)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102398761 (AKT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kinase-like Pkinase_C
Motif
Other DBs
NCBI-GeneID: 102398761
NCBI-ProteinID: NP_001277790
UniProt: M9WQH0
LinkDB All DBs
Position
18
AA seq 481 aa AA seqDB search
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTFEVDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRTHFPQFSYLASIR
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccataagcgcggtgaatatatcaag
acctggcggccccggtacttcctgctgaagagcgacggctccttcattggctataaggag
cggcctgaggcccccgaccagaccttgccccccttaaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagacctcggcccaataccttcgtcattcgctgtctgcagtgg
accacagtcatcgagaggaccttccatgttgactccccagacgagagggaggagtggatg
cgggccatccagatggttgccaacagcctcaagcagaggggcccaggggaggaccccatg
gactacaagtgtggctcccccagcgactcttctgcggccgaggagatggaggtggcagtt
agcaaggcgcgggccaaagtgaccatgaatgacttcgactatctcaaactcctgggcaag
ggcacctttggcaaggtcatcctggtgcgggagaaggccaccggccgctactatgccatg
aagatcctgcggaaggaggtgatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggtcctgcagaacaccaggcacccgttcctcaccgcgctgaagtacgccttccag
acacacgaccgcctgtgcttcgtgatggagtacgccaacggcggcgagctgttcttccac
ttgtcccgggagcgtgtcttcacagaggagcgggcccgcttttatggcgcagagatcgtc
tcagccctggagtacctgcactcgcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaggacggccacatcaagatcaccgacttcggcctgtgcaaggagggc
atcagtgacggggccaccatgaaaaccttctgtgggacccctgagtacctggcgcccgag
gtgctggaggacaacgactatggccgggcggtggactggtgggggctgggcgtagtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggatcacgagcgccttttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccctgaggccaagtccctg
cttgctgggctgcttaagaaggaccctaagcaaaggcttggcggagggcccagcgatgcc
aaggaggtcatggagcacaggtttttccttagtatcaactggcaggacgtggtccaaaag
aagctcctgccacccttcaagcctcaggtcacgtttgaggtcgacacaaggtactttgac
gacgagttcaccgcccagtccatcacagtcacgcccccggaccgctatgacagcctgggc
tcactggagctggaccagcggacgcacttcccccagttttcctatttggccagcatccga
gagtga

DBGET integrated database retrieval system