KEGG   Bubalus bubalis (water buffalo): 102391097
Entry
102391097         CDS       T05912                                 

Gene name
CCNB3
Definition
(RefSeq) G2/mitotic-specific cyclin-B3 isoform X1
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04218  Cellular senescence
bbub04914  Progesterone-mediated oocyte maturation
bbub05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102391097 (CCNB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102391097 (CCNB3)
   04218 Cellular senescence
    102391097 (CCNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102391097 (CCNB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102391097 (CCNB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbub03032]
    102391097 (CCNB3)
   03036 Chromosome and associated proteins [BR:bbub03036]
    102391097 (CCNB3)
DNA replication proteins [BR:bbub03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102391097 (CCNB3)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102391097 (CCNB3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102391097
NCBI-ProteinID: XP_025131963
LinkDB
Position
X
AA seq 1331 aa
MPLPLPSQHSKRETRKSQSSIVPSDREPSEKKDEKYQAKISPSSPQGPLKKRSAFEDLTN
APQSQPVQPKKEANNEFVKDTSKKRNRNTSANRLPENNKMSIKRCKVELSPIVVSTTTMP
NIIDNLLTQGMSTSSKTPNTEEASLFKEPFILKEESTSEDAVLMKRSLSSKKCTNQGVMS
LLQKPLSLQGKSDSDVVQPMTFGKKRKTEEAAITNRTLSFKNMCPYQEKQSCSGEELALQ
DVSVEEDSSFMALQNVRKKPKTEEATFTNPLSSLNKMYTTQRKMSCRKNPLVLQKTTSEE
KPLTKESFKRKPTAEESFFQEPPALQEKHTSEQEISMLKKSLAFQEKTDTEEKSLFKEPL
AFTKQSTTEETTFTMRPLPLEKKCTTQSKMTYSKKTTSGEKALISQLLSFEKKPTPKEES
LFQDLSVLQEKHTDDGAVTLVKKPWALQKKDDEDDFLMEPLSFRKTHTTKEATLPKKPLF
LKRKCTTQGKMYHLKKPLVLQKVTSEEKSLVQEPLPFKKPPTTKESLFQEPSALQGKHTI
LEEASILKKPLVLQKIPTEEESLKKETLIFKKFTTGEATSTNMLLSLKNKCTTQAKSCLT
KPLVLQTISEEKSLIKEPTTEVESLLKEPSALQEKHTTQGYVAPLKKPWALQERIDSKDE
FLMEPLSFRKTHTTNVAVSTEESSSLMKQMCSTQTIMSICQELLGLQNMIGEGKNSFMMP
VSSRKKSSTDEAVLTKTPLSPKMRQITQWNTIIEKTTSEEESLFKKLLPLKKMCTPEEEL
LFQGPSVLKEKHTSLQQASLSKKPLTLQENIASKEESYIKELLTMEKSLVLQKTDTKVDF
SMSLALQKKSTTEEKFFFEKPLVLKEKLSPKAAASIEGQSSFKKQPTAQGKVFLLKKQST
LQENITSEEECIIKQPQALQEKSSVEKETILRESLALQENSTIGEAVWKEPLALQKTLTH
RENTFLKDCTLQIQTSSGVSTTIPESGTGLSNTITMSSSTISKSSTCESNSDKPFSSSDK
RSQQEVIPLGNTDIDFSDPFFSSVYAKDIFSYMKKREEKFVLNKYMTRQTEIDSDMRAIL
VDWLVEVQISFEMSHETLYLAVKLVDHYLMKEICKKDKLQLLGSTAFLIAAKFEECCPPS
VDDILYICNDIYKRDEMLAMEASILKILKFDINIPIAYHFLRRYAKILCFRDRVLSVVMV
AEAHRSGREPFRPKCVYASMKTLTLSRFICELTLVEYDYVQERASKLAAASFFLALCMNK
LGHWAPILEYYSGYRISDLHALVRQLNILLTFHSCNRLKAIHSKYSNKVFFEVTKIPPLD
MLALDRILRCC
NT seq 3996 nt   +upstreamnt  +downstreamnt
atgccgctgccactaccatcccaacactccaaacgtgagactaggaaatctcagtccagc
attgtgcccagtgatcgtgaaccatctgaaaagaaagatgagaagtaccaagcaaagata
tctccatcttcacctcagggaccactcaaaaagagatcagcttttgaagatctcaccaat
gctcctcaaagtcaacctgtccagcccaagaaggaagccaataatgagtttgttaaagat
acttccaagaagagaaacaggaacacatccgctaacaggctgcctgaaaacaataagatg
agtataaaaagatgtaaggtagaactctcaccaatagtagtgtcaaccaccacgatgcca
aacattatagataatctgctcactcagggtatgtctaccagctccaagacacccaatact
gaggaagcatctcttttcaaagagccattcattttaaaagaggaatccacttctgaggat
gcagtcctcatgaagagatcattatcttcaaagaagtgcacaaatcagggggtaatgtcc
ctcttgcagaagccactgtccttgcaggggaagagtgacagtgatgttgtacagccaatg
acttttgggaagaagcgtaaaaccgaggaggcagccatcaccaacaggacattatccttc
aagaatatgtgcccatatcaggaaaagcagtcctgctcgggggaggagttggccttgcag
gacgtcagtgttgaagaggattcttcctttatggcgctccagaatgttaggaagaagcct
aaaactgaggaagcaaccttcaccaacccattatcatctttaaacaaaatgtataccact
cagaggaagatgtcctgtaggaaaaatcctctagtactgcagaagaccacctctgaagaa
aagccactcactaaggagtcttttaagagaaagcctactgctgaggagtcctttttccag
gaaccacctgcattgcaagagaagcacacctctgaacaagaaatatccatgttgaagaaa
tcattggcctttcaggagaagactgacactgaagagaaatcactttttaaggaaccattg
gcttttacgaagcaatctaccactgaggagacaaccttcaccatgaggccattaccttta
gagaaaaagtgtactactcagagtaagatgacctactcgaagaagaccacctctggagag
aaggcactcattagccagttactgtcctttgaaaagaagccaacccctaaggaggagtcc
ctcttccaggacctctcagtgttgcaagagaagcatactgatgatggagcagtgacactt
gtgaagaagccatgggcattgcagaagaaagatgatgaagatgattttcttatggagcca
ctttcctttaggaagactcatactactaaggaggcaacacttcccaagaagccactattt
ttaaagaggaagtgtactactcaggggaagatgtaccacttgaagaagccactagtattg
cagaaggtcacatcagaagagaagtcactcgttcaggagccattaccctttaagaagccg
cctaccactaaggaatcccttttccaagagccatcagcattgcaggggaagcacaccatt
ctagaggaggcatccatcttgaagaagcccttggtcttgcaaaagattccaactgaggag
gaatcacttaaaaaggagactttgatttttaagaagtttaccactggggaggcaacctcc
accaatatgctgttatctttaaagaataagtgtaccactcaggctaagtcctgtttgacc
aagccactagtattgcagaccatttctgaagagaaatcactcattaaggagcctaccact
gaggtggagtccctcttgaaggaaccatctgcactgcaagagaagcacaccactcagggg
tatgtggcccccttgaaaaagccatgggcattacaggagagaatagacagtaaagatgaa
tttcttatggagccactatcatttaggaagacacataccacaaatgtggcagtctctacc
gaggagtcatcatctttaatgaagcaaatgtgttccactcaaacaataatgtctatctgc
caagaactgttggggttgcagaatatgattggtgaaggtaagaattcctttatgatgcca
gtatcatctaggaagaagtcttcaactgatgaggcagttcttaccaagacaccattatct
ccaaaaatgaggcaaatcactcagtggaacaccatcatagagaagaccacctctgaagag
gagtcactctttaagaagttgttgcccttaaaaaaaatgtgtacacctgaagaggagctc
ctcttccagggtccatctgtattgaaagagaaacacacctctctgcaacaggcatccctc
tcaaagaagccattgaccttacaggagaatattgccagtaaagaagaatcatatatcaaa
gaactgttgaccatggagaagtccttagtcttgcagaagactgataccaaagtggacttc
tcgatgtcgttggctttgcagaagaaaagcaccactgaagagaaattctttttcgagaaa
ccattggttctgaaggaaaagctctcccccaaggcagcagccagcatagagggacaatca
tcttttaagaaacagcccactgctcaggggaaggtcttcctcttgaaaaagcagtcgact
ttgcaagagaacatcaccagtgaagaggagtgcattattaagcagccacaggccttgcag
gagaagtccagtgttgaaaaggagacgatcctgagggagtccttggccttgcaggagaat
tccacgattggggaggctgtctggaaggagccattggccttgcaaaagactctcactcac
agagaaaacacctttctcaaagattgcaccctgcaaattcaaaccagctcaggtgtgtcc
accaccatccctgaatctggaacaggcttgtccaacaccatcaccatgtcttccagtacc
ataagcaagtccagtacttgtgaatccaattccgataaacctttctcatcttccgacaaa
agatcacagcaagaggtgatcccactggggaatactgacatagacttcagtgacccattt
ttcagctcagtatatgctaaggatatcttcagttacatgaagaaaagagaggaaaagttt
gtacttaataaatatatgaccaggcagactgaaatcgacagtgacatgagggccattctt
gtggactggttggtggaggtgcagataagctttgagatgagtcatgagaccctgtacttg
gcagtgaagctggtagatcactaccttatgaaggaaatatgcaagaaggacaagttacaa
ctccttggttccactgcttttctgattgcagcaaaatttgaggagtgctgcccacctagt
gtggatgacatcctgtatatctgcaatgacatttataagagagatgagatgctcgccatg
gaagccagcatcctgaaaatcctcaaatttgatatcaacattcccatcgcctatcatttt
ctgcgcagatacgctaagattctgtgctttagggacagggtccttagtgtggtcatggtg
gcagaagcacatcgctcaggcagagaaccatttaggcccaagtgtgtctatgccagcatg
aagacactgaccttgtcccgcttcatctgtgagttgaccctggtggaatatgactatgtc
caggagagggcttccaagctcgctgctgcctccttcttcctggcgctctgcatgaacaag
ctcggacactgggctcctatcctggagtattacagtggctacaggatctctgatcttcac
gccttggtcagacagctgaacatcctactgacttttcattcttgcaataggctcaaggct
atacattccaagtattcgaacaaggtcttctttgaagtcaccaaaatcccacccttggac
atgttggcactggacagaattttgaggtgttgctaa

KEGG   Bubalus bubalis (water buffalo): 102398229
Entry
102398229         CDS       T05912                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04115  p53 signaling pathway
bbub04218  Cellular senescence
bbub04914  Progesterone-mediated oocyte maturation
bbub05166  Human T-cell leukemia virus 1 infection
bbub05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102398229 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102398229 (CCNB2)
   04114 Oocyte meiosis
    102398229 (CCNB2)
   04115 p53 signaling pathway
    102398229 (CCNB2)
   04218 Cellular senescence
    102398229 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102398229 (CCNB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102398229 (CCNB2)
   05170 Human immunodeficiency virus 1 infection
    102398229 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbub03032]
    102398229 (CCNB2)
   03036 Chromosome and associated proteins [BR:bbub03036]
    102398229 (CCNB2)
DNA replication proteins [BR:bbub03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102398229 (CCNB2)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102398229 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF5852 RIH_assoc
Other DBs
NCBI-GeneID: 102398229
NCBI-ProteinID: XP_006049680
LinkDB
Position
11
AA seq 398 aa
MALLRRQTVSTDLENNDTGVNSKPKSHVTIRRAVLEEIGNRVTTRAIQVAKKAQNTKVPV
PPTKTTNVNKHPKPTASVKPVQMDVLAPKGPSPTPQDISMKEENLCQAFSDALLCKIEDI
DTEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCVAVMDRYLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTESEVLEVMRHMAKNVVRVNENMTK
FTAIKNKYASSKLLKISTIPQLNSKAIQELASPLLGRS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcgctgctccgacgccagacggtgtccaccgatttagagaataatgacacgggagtt
aattctaaacctaaaagtcatgtgactatcaggcgggcagttttagaagaaattggaaat
cgggttacaacccgagccatacaagtagctaagaaagcccagaacactaaagtacctgtt
ccacccaccaaaacaacaaatgtcaataagcacccgaaacctactgcttctgtgaaacca
gtgcagatggatgtgttggctccaaagggtccttctcccacacctcaggacatctccatg
aaggaagagaacctctgccaagctttttctgatgccttgctctgcaaaattgaggatatt
gataccgaggactgggagaaccctcagctctgcagcgactatgtaaaggatatctaccag
tatctaaggcagcttgaggttctgcagtccataaacccacatttcctggatgggagagac
ataaacggccgcatgcgtgccatcctggtggactggctggtgcaagtgcactccaagttc
aggctgctgcaggaaacgctgtacatgtgcgttgccgtcatggaccgatatttacaggtt
cagccagtctctcgtaagaagcttcagctggttggcattacggcactgctcttggcttcc
aagtatgaggaaatgttttctccaaacatcgaagactttgtttacatcactgacaatgct
tataccagttctcaaattcgagaaatggaaactctgattttgaaggaactgaaatttgag
ctgggtcgaccgttgccgctacatttcttaaggcgggcatcgaaagctggggaggtcgat
gttgaacagcacactttagccaaatacttgatggagctgactctcgttgactatgatatg
gtgcactatcacccttccaaggtggcggcagctgcttcctgcctgtcccagaaggttcta
ggccaaggaaaatggaacttaaagcagcagtattacaccggctacacagagagcgaggtg
ctggaggtcatgcggcacatggccaaaaacgtcgtgcgtgtcaacgagaacatgaccaag
ttcaccgccatcaagaataagtatgcaagcagcaaactcctgaagatcagcacgattcct
cagttgaactcaaaagccatccaggagcttgcctcacctctgctgggacggtcctag

KEGG   Bubalus bubalis (water buffalo): 102399418
Entry
102399418         CDS       T05912                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04115  p53 signaling pathway
bbub04218  Cellular senescence
bbub04914  Progesterone-mediated oocyte maturation
bbub05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102399418
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102399418
   04114 Oocyte meiosis
    102399418
   04115 p53 signaling pathway
    102399418
   04218 Cellular senescence
    102399418
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102399418
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102399418
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbub03032]
    102399418
   03036 Chromosome and associated proteins [BR:bbub03036]
    102399418
DNA replication proteins [BR:bbub03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102399418
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102399418
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102399418
NCBI-ProteinID: XP_025121522
LinkDB
Position
16
AA seq 593 aa
MAPGPSRAAPPAAAAATAAPAAAPGLGPVPAAAAAAVTGQGGTGPPRAASWTPSPPLRGR
CRQPRAPRPERARRRAESAEESPYRGSLPPAQAPLGRGRAPRRKDDVMLFWPGGLRLPRR
SPQRGRQLLDRPHPPPPRGCDSVRKGSGATWSTHFSTEDLGESKSTSEGRRSHGALDHQN
TKTNAENKLKISMAGAKRLPVATVATSKPGLRPRTALGDIRYKVSKQPQAKLPLKKEAKI
LAAGKVTAKKVAKPLEKAPVPMPEPQPRPETEPEPVKEEKLSPEPILVHTPSPSPMETSS
CAPAEEYLCQAFLDVILAVSDVDAEDGVDPNLCSEYVKDIYAYLRQLEEEQAVKPKYPMG
HEVTGNMRAILIDWLGACSNEIQVTAGEQVHDCSKTDRFMQDNCVPKKMLQLAGVTAVFV
PSKYEETYPPEIGDFAFVTDNSYSKFQIRQTEMKILRAVNFSQGHSLLLHFLQRASKIGE
VNVELHTLVKYLMELTMLDYDMVYFPPRIAAGAFCLALKILDNGEWTPSLQHYLSYTEES
LLVMQHLXKNTVMVNRGLTKHMTIKNRYATSKHDQXQLNSALVQDLAKAVATV
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggcgccggggccgagccgggccgcccctcccgccgccgccgccgctaccgcggctccg
gccgccgcccccggccttggcccggtccccgcggccgccgcggctgccgtgacggggcag
gggggcaccgggccgccccgcgccgcatcctggactccttcccctccgcttcgcggccgc
tgtcgccagccgagagcgccgcggccggagcgagctcggagaagggcggaaagcgctgag
gagagcccctaccgcggctccctcccgcctgcgcaggcgccgttggggagggggcgggct
cctcgccgaaaggatgacgtgatgctcttctggcctggcgggctgcggcttccgaggcgg
tcgccgcagcgcggcaggcaactgctggatcgcccgcatccgccaccccctcggggctgc
gactccgttaggaagggcagcggagcaacttggagcacccatttcagcaccgaggatctg
ggagagagcaagtcgacatctgagggaagaagaagccatggtgctttggatcaccagaac
acaaagactaatgctgaaaataagctgaagatcagtatggcaggggcaaagcgcttgcct
gtggctactgttgcaacctctaagcctgggctgaggccccgaacagctcttggagacatc
cgttacaaagtcagtaaacagccgcaggccaaactgcccctgaaaaaggaagcaaaaatt
ttagctgcaggaaaagttactgctaaaaaagtagcaaaacctctggaaaaggctcctgta
cctatgccggagccccagccgaggccggagacagaaccagagcctgttaaggaagagaaa
ctttcccctgagcccattttggtccatactccctctccaagccccatggaaacatctagc
tgtgcccctgcagaagaatatctgtgtcaggctttcttggatgtaattcttgcagtgagt
gatgtggatgcagaagacggagtggatccaaacctctgtagtgaatatgtaaaagatatc
tatgcttatctgagacaacttgaggaagagcaagcagtcaaaccaaaatacccaatgggt
catgaagtcactggaaacatgagagccatcctaattgactggctaggtgcatgttcaaat
gaaattcaggttactgcaggagaacaggtacatgactgttccaaaactgatcggttcatg
caggataattgtgtgcccaagaagatgctgcagctggctggagtcactgccgtgtttgtt
ccaagcaaatatgaggaaacgtaccctccagaaatcggtgactttgcctttgtgactgac
aattcttactccaagttccaaatcagacagacagaaatgaagattctaagagctgtaaat
tttagtcagggtcactctctactcctgcatttccttcagagagcatctaagattggagag
gttaatgttgagctacatactctggtcaaatatttgatggaactaactatgctggactat
gatatggtgtactttcctcctcggattgcagcgggagctttttgcttagcactgaaaatt
cttgataatggtgaatggacaccatctctacagcattacctgtcatacactgaagaatcc
cttcttgttatgcaacacctgngcaaaaatacggtcatggtgaatcgtgggcttacaaag
cacatgactatcaagaacaggtatgccacatctaagcatgatcagncacagctgaattct
gcactagttcaagatttagccaaggctgtggcaacagtgtaa

KEGG   Bubalus bubalis (water buffalo): 102413044
Entry
102413044         CDS       T05912                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04115  p53 signaling pathway
bbub04218  Cellular senescence
bbub04914  Progesterone-mediated oocyte maturation
bbub05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102413044 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102413044 (CCNB1)
   04114 Oocyte meiosis
    102413044 (CCNB1)
   04115 p53 signaling pathway
    102413044 (CCNB1)
   04218 Cellular senescence
    102413044 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102413044 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102413044 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbub03032]
    102413044 (CCNB1)
   03036 Chromosome and associated proteins [BR:bbub03036]
    102413044 (CCNB1)
DNA replication proteins [BR:bbub03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102413044 (CCNB1)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102413044 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Trypan_PARP
Other DBs
NCBI-GeneID: 102413044
NCBI-ProteinID: XP_006059003
LinkDB
Position
19
AA seq 427 aa
MALRITRNTKINAENKAKISMAGAKRVPVAAVATSKPGLRPRTALGDIGNKVSEQPQAKL
PLKKEAKTLAAGKVTAKKVPKPLEKAPVPVPEPQPEPEPETEPVKEEKLSPEPILVDTPS
PSPMETSGCAPAEEYLCQAFSDVILAVSDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQA
VKPKYLMGREVTGNMRAILIDWLVQVQIKFRLLQETMYMTVSIIDRFMQDNHVPKKMLQL
VGVTAMFVASKYEEMYPPEIGDFAFVTDNTYSKFQIRQMEMKILRALNFSLGRPLPLHFL
RRASKIGEVDVELHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQ
HYLSYTEESLLVVMQHLAKNVVMVNRGLTKHMTIKNKYATSKHAKISTLAQLNSALVQDL
AKAVAKV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcgctccggatcaccaggaacacgaagattaatgctgaaaataaggcgaagatcagt
atggcaggggccaagcgcgtgcctgtggccgctgttgcaacatctaagcccgggctgagg
ccccgaacagctcttggagacatcggtaacaaagtcagtgaacaaccgcaggccaaactg
cctctgaaaaaggaagcaaaaactttagctgctggaaaagttactgctaaaaaagtacca
aaacctctggaaaaggctcctgtacctgtgccggagccccagccggagccagagccggaa
accgagcctgttaaggaagagaaactttcccccgagcctattttggttgatactccctct
ccaagccccatggaaacatctggctgtgcccctgcagaagagtatctgtgtcaggctttc
tcagatgtaattcttgcagtgagtgatgtggatgcagaagacggagcggatccaaacctt
tgtagtgaatatgtaaaagatatctatgcttatctaagacaacttgaggaagagcaagca
gtcaaaccaaaatacctaatgggtcgtgaagtcactggaaacatgagagccatcctcatt
gactggctagtgcaagttcaaataaaattcagattactgcaggagaccatgtacatgact
gtttccataattgatcggttcatgcaggataaccacgtgcccaagaagatgctgcagctg
gtgggagtcaccgccatgtttgttgcaagcaaatatgaggaaatgtaccctccagaaatc
ggtgactttgcctttgtgactgacaacacctacagcaagtttcaaatcagacagatggaa
atgaagattctaagagctttaaattttagtctgggtcgccctctacccctgcatttcctt
cggagagcatctaagattggagaggttgatgttgagctacatactctggccaaatatttg
atggaactaactatgctggactacgatatggtgcactttcctccttctcagattgcagca
ggagctttttgcttagcactgaaaattcttgataatggtgaatggacaccaactctacag
cattacctgtcatacactgaagaatcccttcttgttgttatgcaacacctggcaaagaat
gtggtcatggtgaaccgtgggcttacaaagcacatgactatcaagaacaagtatgccaca
tctaagcacgctaagatcagcactctagcacagctgaattctgcactagttcaagactta
gccaaggctgtggcaaaggtgtaa

DBGET integrated database retrieval system