KEGG   Bubalus bubalis (water buffalo): 102391239Help
Entry
102391239         CDS       T05912                                 

Gene name
ERG
Definition
(RefSeq) transcriptional regulator ERG isoform X1
  KO
K09435  transcriptional regulator ERG
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub05202  Transcriptional misregulation in cancer
bbub05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102391239 (ERG)
  09162 Cancer: specific types
   05215 Prostate cancer
    102391239 (ERG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102391239 (ERG)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    102391239 (ERG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_2 SAM_3 SAM_1
Motif
Other DBs
NCBI-GeneID: 102391239
NCBI-ProteinID: XP_025149771
LinkDB All DBs
Position
1
AA seq 486 aa AA seqDB search
MIQTVPDPAAYIKEALSVVSEDQSLFECAYGTPHLPKTDMTASSSGDYGQTSKMSPRVPQ
QDWLSQPPARVTIKMECNPNQVNGSRNSPDECSMAKGGKMVGSPDTVGMNYSSYMEEKHM
PPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVDILLFQNIDGKELCKMTK
DDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPN
TSVYPEATQRITTRPDLPYEPPRRSAWTSHGHPAPQSKAAQPSPSTVPKTEDQRPQLDPY
QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGE
RKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS
DLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPSARLPASHMPS
HLGTYY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgattcagactgtcccagacccagcagcttatatcaaggaagcgttatcagtcgtgagc
gaggaccagtcactgtttgagtgcgcctacggcacgccgcacctgcccaagacggacatg
accgcgtcctcctccggcgactatggacagacatccaagatgagcccacgcgtccctcag
caggactggctgtctcaacccccagccagggtcaccatcaagatggaatgtaaccctaac
caggtgaacggctcaaggaactcccctgatgagtgcagcatggccaaaggtgggaagatg
gtgggcagcccggacaccgtcgggatgaactacagcagctacatggaggagaagcacatg
ccacccccaaacatgaccaccaacgagcgccgcgtcatcgtccccgcagatcccacgcta
tggagtacagaccatgtccggcagtggctggagtgggcagtcaaagaatacgggcttccg
gacgttgacatcttattattccagaatatcgacgggaaggagctgtgcaagatgaccaaa
gatgacttccagaggctcaccccgagctacaacgctgacatccttctgtcgcacctccac
tacctcagagagacacctcttccacatttgacttcagatgatgttgataaagccttacaa
aactctccacggttaatgcatgctagaaacacagggggtgcagcttttattttcccaaat
acttcagtatatcccgaagctacgcaaagaattacaactaggccagatttaccttatgaa
ccacccaggagatctgcctggaccagccatggccaccccgccccccagtcgaaagctgct
cagccgtctccttccacagtgcccaaaactgaagaccagcgtcctcagctagatccttac
cagattcttggacccacaagtagccgccttgcgaatccagggagcgggcagatccagctt
tggcagttcctgctggagcttctgtctgacagctcaaattccaactgcatcacctgggag
ggcaccaacggggagttcaagatgaccgacccggacgaggtggcacggcgctggggggag
cggaagagcaagcccaacatgaactatgacaagctcagccgggccctccgctactactac
gacaagaacatcatgaccaaagtccacgggaagcgctatgcctacaagtttgacttccac
gggatcgcccaggccctgcagccccaccccccggagtcctctctgtacaagtacccctcg
gacctcccctacatgggctcctatcacgcccacccgcagaagatgaactttgtcgccccc
caccctccggccctccccgtgacgtcatccagttttttcgccgccccgaacccatactgg
aattcacccacgggggggatctaccccagcgctaggctcccagccagccatatgccttcg
catctgggcacttactactaa

DBGET integrated database retrieval system