KEGG   Bubalus bubalis (water buffalo): 102391502Help
Entry
102391502         CDS       T05912                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00062  Fatty acid elongation
bbub00071  Fatty acid degradation
bbub00280  Valine, leucine and isoleucine degradation
bbub00310  Lysine degradation
bbub00380  Tryptophan metabolism
bbub00410  beta-Alanine metabolism
bbub00640  Propanoate metabolism
bbub00650  Butanoate metabolism
bbub01100  Metabolic pathways
bbub01200  Carbon metabolism
bbub01212  Fatty acid metabolism
Module
bbub_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
bbub_M00085  Fatty acid elongation in mitochondria
bbub_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102391502 (ECHS1)
   00650 Butanoate metabolism
    102391502 (ECHS1)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    102391502 (ECHS1)
   00071 Fatty acid degradation
    102391502 (ECHS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102391502 (ECHS1)
   00310 Lysine degradation
    102391502 (ECHS1)
   00380 Tryptophan metabolism
    102391502 (ECHS1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102391502 (ECHS1)
Enzymes [BR:bbub01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     102391502 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 102391502
NCBI-ProteinID: XP_025130244
LinkDB All DBs
Position
23
AA seq 290 aa AA seqDB search
MAALRALLPSVRAPLRPWLFCPVQRSFASSAAFEYIITAKKGKNSNVGLIQLNRPKALNA
LCNGLIVELNQALQAFEEDPAVGAIVLTGGEKVFAAGADIKEMQSFTFQNCYSGGFLSHW
DQLTRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEAVVEEAIQCAEKIASNSKIVTAMA
KEAVNAAFEMTLAEGVKLEKKLFYSTFATEDQKEGMAAFVEKRKADFKDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttacgtgccctgctgcccagcgtccgcgccccgctgcggccctggctcttc
tgcccggtgcagcgctccttcgcctcgagcgcagcctttgagtacatcatcacagcaaag
aagggaaagaacagcaacgtggggttgatccagctgaaccgccccaaggccctcaatgcg
ctctgcaacggcctgatcgtggagctcaaccaggcactgcaggccttcgaggaagaccca
gccgtgggggccattgtcctcacaggcggggagaaggtgtttgcagctggagccgacatc
aaggaaatgcagagcttcacgttccagaactgttactctggcgggtttttgagccactgg
gaccagctcacacgtgtcaagaagccagtcatagctgctgtcaatggctatgcccttggt
ggtggctgtgagcttgccatgatgtgtgacatcatttatgctggagagaaagcccagttt
gggcagccggagattctaataggaaccatcccaggtgcaggcggcacccagagactgacc
cgtgccgtcggaaagtcactggccatggagatggtcctcactggtgaccggatctcagcc
caggatgccaagcaagcaggtctcgtaagcaaaatttttcctgttgaggcagtggttgaa
gaagccatccaatgtgcagaaaaaattgccagcaactctaaaattgtaacagccatggcc
aaagaagcagtgaacgcagcttttgaaatgacattagctgagggcgttaaattggagaag
aagctcttctactcaacttttgccactgaagaccagaaggaagggatggccgcatttgtg
gagaagagaaaggccgacttcaaagaccagtga

KEGG   Bubalus bubalis (water buffalo): 102398211Help
Entry
102398211         CDS       T05912                                 

Gene name
HADHA
Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00062  Fatty acid elongation
bbub00071  Fatty acid degradation
bbub00280  Valine, leucine and isoleucine degradation
bbub00310  Lysine degradation
bbub00380  Tryptophan metabolism
bbub00410  beta-Alanine metabolism
bbub00640  Propanoate metabolism
bbub00650  Butanoate metabolism
bbub01100  Metabolic pathways
bbub01200  Carbon metabolism
bbub01212  Fatty acid metabolism
Module
bbub_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
bbub_M00085  Fatty acid elongation in mitochondria
bbub_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102398211 (HADHA)
   00650 Butanoate metabolism
    102398211 (HADHA)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    102398211 (HADHA)
   00071 Fatty acid degradation
    102398211 (HADHA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102398211 (HADHA)
   00310 Lysine degradation
    102398211 (HADHA)
   00380 Tryptophan metabolism
    102398211 (HADHA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102398211 (HADHA)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     102398211 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     102398211 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 102398211
NCBI-ProteinID: XP_006046287
LinkDB All DBs
Position
12
AA seq 762 aa AA seqDB search
MVASRAIGSLSRFTACRTLRCSGYICRSFTRSSALLTRTHINYGVKGDVAVIRINSPNSK
VNTLSQELHSEFMEVMNEVWSSSQIRSAVLISTKPGCFIAGADLNMLNSCTTSQEVTQIS
QEAQKMFEKLEKSTKPVVAAINGSCLGGGLELAISCQYRIATKDKKTVLGSPEVLLGILP
GAGATQRLPKMVGIPAAFDMMLTGRGIRADRAKKMGLVDQLLEPLGPGVKPPEERTIEYL
EEVAVTFAKGLADKKITPKRDKGLVEKLTSYALSIPFVRQQIYKKVEEKVRKQTKGLYPA
PLKIIDVVKTGIEQGSNAGYLSESQTFGELIMTKESKALMGLYRGQTQCKKNKFGAPQKE
VKQLAVLGAGLMGAGIAQVSVDKGLQTILKDTTLPALGRGQQQVFKGLNDKVKKKTLTSF
ERDAMFSNLIGQLDYRGFEKADMVIEAVFEDLNLKHRVLREAEAVIPDHCVFASNTSALP
IGEIATVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTTASAVDVGLRQGKVIIVVK
DGPGFYTTRCLAPMMSEVIRILQEGVGPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVA
ENLGKEFGERFAGGSLEMLQQMISKGFLGRKSGKGFYIYQEGVKNKNLNSDMDSILASLK
MPSQPDVSSDEDIQYRLVTRFVNEAILCLQEGVLATPTEGDIGAVFGLGFPPYLGGPFHF
VDLYGAQKIVDRLRKYEAAYGKQFTPCQLLVDHANNPNKKFY
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctctcgagcaattggcagcctcagccgctttactgcctgccggacgctccgc
tgctcaggttatatttgccgcagttttacaaggtcctctgctttgctgaccagaacccat
attaactatggagtcaaaggggatgtggcagttattcgaattaactcacccaattcaaag
gtgaatactctaagtcaagaactgcattcagagttcatggaagtaatgaatgaagtctgg
tctagcagtcagatcagaagtgccgtccttatctcaacaaagccaggctgcttcattgca
ggtgctgatctgaacatgttaaattcttgtacgacctctcaagaagtaacgcaaatatca
caagaagcacagaaaatgtttgagaaacttgagaagtccacaaagcctgttgtggctgcc
atcaatggatcctgcttaggaggaggacttgagcttgccatttcatgccaatacagaata
gcaacaaaagataagaaaacagtattgggttcccctgaggtcttgctgggaatcttacca
ggagcaggagccacacaaaggctgcccaagatggtgggtatacctgctgcttttgacatg
atgctgactggtagaggcattcgtgcagacagagcaaagaaaatgggactggttgaccaa
ctgctggaaccactgggaccaggagtaaaacctccagaggaacggacaattgaatactta
gaagaagttgcagttacttttgccaaaggactagctgataaaaagatcactccaaagaga
gacaagggattggtagaaaaattgacgtcatacgccttgagtattccatttgtcaggcaa
cagatttacaaaaaggtggaagaaaaagtacgaaagcagaccaaaggcctttatcctgca
cccctgaaaataattgatgtagtgaagactggaatcgagcaagggagtaatgctggctat
ctctctgaatctcagacatttggagagctcataatgaccaaagaatcaaaagccttgatg
ggactttaccgtggtcaaacccaatgcaagaagaataaatttggagctccgcagaaggag
gttaagcagcttgctgttcttggtgcagggctgatgggagccggcattgctcaagtctcc
gtggataagggcctacagaccatacttaaggacactacactgcccgcgctgggtcgagga
cagcagcaggtgttcaaaggattgaatgataaagtgaagaagaaaacactaacatcattt
gaaagggatgccatgttcagcaacttgattgggcagcttgattaccggggttttgaaaag
gccgacatggtgattgaagccgtttttgaggacctcaaccttaagcacagagtgctgagg
gaagcagaagcggtgattccagatcactgtgtctttgccagcaacacgtctgctcttccg
atcggtgagattgctactgtcagtaaaagacctgagaaggtgatcggcatgcactacttc
tctcccgtggacaagatgcagctgctggagattatcacaactgagaagacttcgaaggac
acaactgcctctgctgtagatgttggcctcagacaagggaaggtcatcattgtggttaag
gatggacctggcttctataccaccaggtgcctcgcacccatgatgtctgaagtcatcaga
attctccaggaaggagtcggccctaagaagctggactccctgaccaccagcttcggcttc
cctgtgggcgccgctacgctggtggatgaagttggtgtggatgtcgcaaaacacgtggca
gaaaatctcggcaaagagtttggggagcggtttgcaggcggaagcctggaaatgctgcag
cagatgatatccaagggcttcctgggtcgcaagtctgggaagggcttttacatctaccag
gagggtgtgaagaacaagaatttgaattctgatatggacagtattttggcaagtctgaag
atgccttctcagcctgacgtctcctcagacgaagacatccagtaccgcctagtgaccagg
tttgtgaacgaagccatcctgtgcctgcaggaaggggttttggccacgcccacagaggga
gacatcggtgcagtctttgggcttggcttccccccgtatcttggagggcccttccacttt
gtggatctgtacggggcacagaaaatagtggaccggctccggaagtacgaggctgcctat
ggaaaacagttcaccccgtgtcagctgcttgtggaccatgccaacaaccctaacaagaag
ttctactaa

KEGG   Bubalus bubalis (water buffalo): 102404255Help
Entry
102404255         CDS       T05912                                 

Gene name
EHHADH
Definition
(RefSeq) peroxisomal bifunctional enzyme
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00071  Fatty acid degradation
bbub00280  Valine, leucine and isoleucine degradation
bbub00310  Lysine degradation
bbub00380  Tryptophan metabolism
bbub00410  beta-Alanine metabolism
bbub00640  Propanoate metabolism
bbub00650  Butanoate metabolism
bbub01100  Metabolic pathways
bbub01200  Carbon metabolism
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04146  Peroxisome
Module
bbub_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
bbub_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102404255 (EHHADH)
   00650 Butanoate metabolism
    102404255 (EHHADH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102404255 (EHHADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102404255 (EHHADH)
   00310 Lysine degradation
    102404255 (EHHADH)
   00380 Tryptophan metabolism
    102404255 (EHHADH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102404255 (EHHADH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102404255 (EHHADH)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102404255 (EHHADH)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     102404255 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     102404255 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     102404255 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 TrkA_N UDPG_MGDP_dh_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 102404255
NCBI-ProteinID: XP_006071136
LinkDB All DBs
Position
1
AA seq 723 aa AA seqDB search
MAEFTRLQNCLALIRLRNPPVNAISTTVARGIKESLQKAITDDTVKAIVICGADGIFCAG
ADIREFKVRKTFDIQLGDIVDEIQRNKKPVVAAIQKLALGGGLELALGCHYRIAHAEAQI
GFPEVTLGILPGARGTQLLPRLVGVPAALDLIISGRHISANEALKLGIIDKIVNSDPIEE
SIKFAQRISDQSPESRRICNMPVPSLPNMDAIFSEALLQVRKRYPGWLSPEACVRAVQAA
VQYPYDMGSKKEKELGLYLNTSGQAKALQYVFFAERMANKWSTPSGASWKTALGRPISSV
GVLGLGTMGRGIVISFAKAQIPVIAVESDKKQLETASKMITSILEKEASKMQQSGRPWSG
PKPRLTTSMKELSGVDLVIEAVYEDMNLKKRVFAELSAVCKPEALLCTNTSALDIDEIAS
SSDRPHLVIGTHFFSPAHVMKLLEVIPSQFSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLRSYYDQTYFLLEEGSKPEEIDEVLEEFGFKMGPFRVSDLAGLDIGWKSRKGQGLT
GPTLPPGSSARKRGGRRYCPIPDMLCESGRFGQKTGKGWYLYDKPLGRIHKPDPWLSQFL
AQYREIYHIEPRIISRDEILERCLYSLINEAFRILGEGMAAIPEHIDVIYLHGYGWPRHR
GGPMFYASTVGLPTVLEKLQKYHRQNPDIPQLEPCDYLKKLASQGNLPLEEWQSLSGLPS
SKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttcacgcggctgcagaactgcctggcactgatccgtctacgaaacccgcca
gtcaatgcgatcagtacaactgttgcccgtggaataaaagagagtctgcagaaagctata
acagatgatacagttaaagccattgtgatttgtggagcagatggcatcttctgtgcaggt
gccgatattagagaattcaaagttcgtaagacctttgacatacaactgggagatatagta
gatgaaatacagagaaacaagaagcctgtggtggcagctatccaaaagttggctttagga
gggggactggagctggccctgggctgtcactatagaattgcccatgcagaggctcaaatt
ggcttcccagaagtcacactaggaatccttcctggtgcaagaggaacccagcttctcccc
agacttgttggagtgcctgctgcacttgatttgattatctcaggaagacatatttcagca
aatgaagcacttaagctgggtattatagataaaattgtgaactcagacccaattgaagaa
tcgatcaaatttgcccagagaatttcagatcaatctccagaatcccgtagaatctgcaac
atgccagtcccgagcttgcccaacatggatgccattttcagtgaagcccttctgcaggtg
cggaagcggtaccctgggtggctgtctccggaggcctgtgtccgagcagtccaggctgct
gtccaatatccatatgacatgggcagcaagaaggaaaaggagcttggcctgtaccttaat
acctcagggcaggccaaggccctgcaatatgttttctttgctgagaggatggcaaataag
tggtccactccctctggagcttcctggaaaacagcgttgggacggcccatctcctctgtt
ggcgttctcggcttaggaacaatgggccgaggcattgtcatttcttttgcaaaggcccag
atccccgtgattgccgtagaatcagacaagaagcagctagagactgcaagcaagatgata
acctccatcttggaaaaggaagcatccaaaatgcagcagagtgggcgcccttggtcagga
ccaaaacccaggttaactacatctatgaaagagctcagtggtgtagatttagtcattgaa
gcagtgtatgaggacatgaacctgaagaagcgtgtctttgctgaactatcagctgtatgc
aagccagaagcactcttatgcaccaacacttccgccctggacattgatgagattgcttct
tccagtgaccgtcctcacttggtcattggcacccacttcttctcaccagctcacgtcatg
aagttgttagaggttattcccagccaattctcttcccccaccaccattgctacggttatg
aatttatcaaaaaagattaagaagattggagtagttgtaggcaattgttttggatttgtt
gggaatcgaatgctgaggtcttattatgatcagacatacttcttattagaagaaggcagt
aaaccagaggagatagatgaggtgctggaagagtttggtttcaaaatgggaccttttaga
gtgtctgatcttgctgggttggatataggttggaaatcccgcaaagggcaaggtcttact
ggacctacattgcctccaggaagttctgcccggaagcgaggcggccggagatattgccca
attcctgatatgctgtgtgagtcaggacggtttggtcagaagacaggtaagggttggtac
ctttatgataagcccctggggaggatccacaaacctgatccctggctttcccaatttctg
gcacagtacagggaaatatatcacatcgaaccacgtatcattagccgggatgagatcctc
gaacgctgcctatattcactcatcaatgaggcatttcgcatcttgggagaagggatggcg
gctatcccagagcacattgatgttatctatttacatgggtatggatggccaaggcacagg
ggtgggcccatgttctatgcttccacagttgggttgcccacagtgctagagaagttgcag
aaataccacaggcagaatcctgatattccccaactggagccttgtgactatcttaaaaaa
ctggcttcccagggaaaccttcctctggaagagtggcaaagcttgtcaggactccccagc
agtaaactgtga

DBGET integrated database retrieval system