KEGG   Bubalus bubalis (water buffalo): 102391835
Entry
102391835         CDS       T05912                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05215  Prostate cancer
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102391835 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102391835 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    102391835 (GSTP1)
   00983 Drug metabolism - other enzymes
    102391835 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102391835 (GSTP1)
   05204 Chemical carcinogenesis
    102391835 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102391835 (GSTP1)
   05215 Prostate cancer
    102391835 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102391835 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102391835 (GSTP1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102391835 (GSTP1)
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102391835 (GSTP1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3 Mei4
Other DBs
NCBI-GeneID: 102391835
NCBI-ProteinID: XP_006072786
LinkDB
Position
5
AA seq 210 aa
MPPYTIVYFPTRGRCEALRMLLADQDQSWKEEVVTKESWLQGPLKASCLYGQLPKFQDGD
LTLYQSNAILRHLGRSFGLYGTDEREAALVDMVNDGLEDLRRRCGHLIHHKREEDKAQYV
QELPAHLKPFETLLSQNQGGQAFIVGNQISFADYNLLDLLLNHQVLVPGCLDPFPLLSAY
VARLSARPKLKAFLASPEHVNRPIFGSRKI
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccatcgtctacttcccgacccgagggcgctgcgaggccctgcgcatg
ctgctggccgaccaggaccagagctggaaggaggaggtggtcaccaaggagagctggctg
cagggcccactcaaggcctcctgcctgtatgggcagctccccaagttccaggatggagac
ctcaccctgtaccagtctaatgccatcctgcgacacctgggccgctcctttgggctctac
ggcacagacgagcgggaggcggcactggtggacatggtgaacgatggcctggaagacctc
cgcaggcgctgcggccacctcattcaccacaagcgcgaggaggacaaagcccaatatgtt
caggagctgccggcgcacctgaagcctttcgagaccctcctgtcccagaatcaggggggc
caggccttcatcgtgggcaaccagatctccttcgccgactacaacctgctggacctgctg
ctcaatcatcaggtgctggtccccggctgcctggaccccttccccctactctcggcctac
gtggcccgcctcagcgcccggcccaagctcaaggcattcctggcctccccggagcatgtg
aaccgtcccatctttggaagccgcaaaatatga

KEGG   Bubalus bubalis (water buffalo): 102393812
Entry
102393812         CDS       T05912                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102393812 (MGST2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102393812 (MGST2)
   00982 Drug metabolism - cytochrome P450
    102393812 (MGST2)
   00983 Drug metabolism - other enzymes
    102393812 (MGST2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102393812 (MGST2)
   05204 Chemical carcinogenesis
    102393812 (MGST2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102393812 (MGST2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102393812 (MGST2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102393812 (MGST2)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102393812 (MGST2)
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102393812 (MGST2)
SSDB
Motif
Pfam: MAPEG UbiA
Other DBs
NCBI-GeneID: 102393812
NCBI-ProteinID: XP_006079322
LinkDB
Position
17
AA seq 146 aa
MAGNSILLAALSVLSACQQSYFAMQVGKARSKYKVTPPSVSGSPDFERIFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYSRHQYFWGYAEAAKKRVTGFRLSLGVLALLTV
LGAVGILNSFLDEYLDIDIAKKLRHF
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcagggaattcgatattgctggctgcactctctgtcctctcagcctgtcagcaaagt
tattttgctatgcaggtaggaaaggcgagatcgaaatacaaagttacacccccatcagtc
tctgggtcgccagattttgagagaatatttcgtgcacagcaaaactgtgtggagttttac
ccaatattcataatcacattgtggatggctggatggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatctattcccgtcaccagtatttctggggatacgcagaagct
gctaaaaaaagggtcactggtttccggctgagtctgggggttttggccttgttgactgtc
ctaggtgccgtggggattctgaacagttttctggatgaatacctggacatcgatattgcc
aagaaactgaggcacttctaa

KEGG   Bubalus bubalis (water buffalo): 102395607
Entry
102395607         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05215  Prostate cancer
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102395607
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102395607
   00982 Drug metabolism - cytochrome P450
    102395607
   00983 Drug metabolism - other enzymes
    102395607
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102395607
   05204 Chemical carcinogenesis
    102395607
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102395607
   05215 Prostate cancer
    102395607
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102395607
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102395607
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102395607
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102395607
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 102395607
NCBI-ProteinID: XP_025142574
LinkDB
Position
5
AA seq 210 aa
MPPYTIVYFPVQGRCEAMRMLLADQDQSWKEEVVAMQSWLQGPLKASCLYGQLPKFQDGD
LTLYQSNAILRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYVSLIYTNYEAGKEDYV
KALPQHLKPFETLLSQNKGGQAFIVGDQISFADYNLLDLLRIHQVLAPSCLDSFPLLSAY
MARLNSRPKLKAFLASPEHMNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccatcgtctacttcccggttcaagggcgctgcgaggccatgcgcatg
ctgctggccgaccaggaccagagctggaaggaggaggtggtagccatgcaaagctggctg
cagggcccactcaaggcctcctgcctgtacgggcagctccccaagttccaggacggagac
ctcactctgtaccagtccaatgccatcctgcgacacctgggccgcaccctcgggctgtat
gggaaggaccagcgggaggcggccctggtggacatggtgaatgacggtgtagaggacctt
cgctgcaaatacgtctccctcatttacaccaactacgaggcgggcaaggaggactatgtg
aaggcgctgccccagcacctgaagcctttcgagactctgctgtcccagaacaagggtggc
caggccttcattgtgggcgaccagatctcctttgcggattacaacctgctggacctgctt
cggattcaccaagtcctggcccccagctgtctggactccttccccctgctctcagcctac
atggcccgcctcaactcccggcccaagctcaaggccttcctggcctccccggagcacatg
aatcggcccatcaacggcaatgggaaacagtga

KEGG   Bubalus bubalis (water buffalo): 102395774
Entry
102395774         CDS       T05912                                 

Gene name
GSTM3
Definition
(RefSeq) glutathione S-transferase Mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102395774 (GSTM3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102395774 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    102395774 (GSTM3)
   00983 Drug metabolism - other enzymes
    102395774 (GSTM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102395774 (GSTM3)
   05204 Chemical carcinogenesis
    102395774 (GSTM3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102395774 (GSTM3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102395774 (GSTM3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102395774 (GSTM3)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102395774 (GSTM3)
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102395774 (GSTM3)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_6
Other DBs
NCBI-GeneID: 102395774
NCBI-ProteinID: XP_006065036
LinkDB
Position
6
AA seq 225 aa
MASSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKRYTCGEAPDYDKSQWLDVKFKLDLD
FPNLPYLMDGKNRLTQSNAILRYIARKHNMCGDTEEERIRVDIMENQIMDFRMQLVQLCY
NPDHDKLKPQYLEQLPGQLKQFSLFLGKYSWFAGEKLTFVDFLTYDVLDQNRMFEPKCLD
EFPNLKAFMCRFEALEKIATYMQSDRFLKMPVNNKMAQWGNRRIC
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcttcgtcaaagtctatggttctaggttactgggatattcgcgggctggcgcacgcc
atccgcatgctcctggagttcacggatacatcctatgaagagaaaagatacacgtgcggg
gaagctcctgactatgataagagccagtggctggatgtgaaattcaaactagacctggac
tttcctaacctgccctatctcatggacggtaagaacaggctgacccagagcaatgccatc
ttgcgctacatcgcccgcaagcacaatatgtgcggtgacactgaagaggaaaggattcga
gtggacatcatggagaaccaaataatggattttcgcatgcaactggtacaactctgctac
aaccctgaccacgacaagctgaagcctcagtacttggaacagctacctggacaactgaaa
cagttctccttgttcttggggaaatactcatggtttgcaggggaaaagctcacctttgtg
gatttcctcacctatgatgtcttagatcagaaccgtatgtttgagcccaagtgcctggat
gaatttccgaatctgaaggctttcatgtgccgttttgaggctttggagaaaatagctacc
tacatgcagtctgaccgcttccttaagatgcctgtcaacaacaagatggcccagtggggc
aacaggagaatctgctga

KEGG   Bubalus bubalis (water buffalo): 102396303
Entry
102396303         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase Mu 1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102396303
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102396303
   00982 Drug metabolism - cytochrome P450
    102396303
   00983 Drug metabolism - other enzymes
    102396303
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102396303
   05204 Chemical carcinogenesis
    102396303
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102396303
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102396303
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102396303
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102396303
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102396303
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 102396303
NCBI-ProteinID: XP_006065038
LinkDB
Position
6
AA seq 218 aa
MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKLTQSNAILRYIARKHNMCGETEEEMIRVDILENQVMDVRLAMARICYSPDF
EKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKLTYVDFLVYDVLDMHRIFEPKCLDAFPN
LKDFISRFEGLKKISAYMKSSRFLPGPLFMKLAVWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccatgatcctgggttactgggacatccgagggctggcccatgccatccgccttctc
ctggagtacacagacacaaactatgaggagaggcagtactcggtaggagatgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggacttccccaatctg
ccctacttaatcgatgggactcacaagctcacccagagcaacgccatccttcggtacatc
gctcgcaagcacaacatgtgtggggagacagaggaggagatgattcgtgtggacattttg
gagaaccaggttatggatgtccgcttggccatggccaggatctgctacagccctgacttt
gagaaactgaagcccggtttcttgaaggagatccctgaaaaaatcaagctgttctcagag
tttctggggaagaggccttggtttgcaggggacaagctcacctatgtggatttcctggtt
tacgacgtccttgacatgcaccgcatatttgagcccaagtgcctggacgcattcccaaac
ctgaaggacttcatttctcgttttgagggcctgaagaagatctctgcctacatgaagtcc
agccgcttcctcccaggccctctgttcatgaagcttgccgtgtggggcaacaagtag

KEGG   Bubalus bubalis (water buffalo): 102397004
Entry
102397004         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase Mu 1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102397004
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102397004
   00982 Drug metabolism - cytochrome P450
    102397004
   00983 Drug metabolism - other enzymes
    102397004
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102397004
   05204 Chemical carcinogenesis
    102397004
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102397004
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102397004
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102397004
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102397004
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102397004
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_2 GST_C_6 GST_N_3
Other DBs
NCBI-GeneID: 102397004
NCBI-ProteinID: XP_006065040
LinkDB
Position
6
AA seq 218 aa
MPMILGYWDIRGLAHAIRLLLEYTDSNYEEKKYTMGDAPDYDRSQWLSEKFTLGLDFPNL
PYLIDGAHKLTQSNAILRYIARKHNMCGETEEEKIRVDILENQTMDVRLHMARICYSPDF
ETLKPGFLKEIPEKMKLFSDFLAKRPWFAGDKLTYVDFLAYDVLDRHRIFEPTCLDEFPN
LKDFITRFEGLKRISAYMKSSRFHPNPMFLKLAVWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccatgatcctgggttactgggacattcgtgggctggcccatgccatccgcctgctc
ctggagtatacagactcaaactatgaggagaagaagtacacgatgggggacgctcccgac
tatgacagaagccagtggctgagtgaaaaattcacgctgggcctggacttccccaatttg
ccctacttaattgatggagctcacaagctcacccagagcaatgccatccttcgctacatc
gctcgcaagcacaacatgtgtggggagacagaggaggagaagatccgtgtggacattttg
gagaaccagactatggatgtccgattgcacatggccaggatctgttacagccctgacttt
gagacactgaagcctggtttcttgaaggagatccctgaaaagatgaagctcttctcagat
tttctggcgaagaggccttggttcgcaggggacaagctcacctatgtggatttcttggct
tatgatgtccttgaccggcaccgcatatttgaacctacatgtctggatgaatttccaaac
ttgaaagacttcattacccgtttcgagggcctgaagaggatctctgcctacatgaagtct
agccgcttccacccaaaccctatgtttctaaagcttgccgtgtggggaaacaagtaa

KEGG   Bubalus bubalis (water buffalo): 102397766
Entry
102397766         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase Mu 1-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102397766
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102397766
   00982 Drug metabolism - cytochrome P450
    102397766
   00983 Drug metabolism - other enzymes
    102397766
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102397766
   05204 Chemical carcinogenesis
    102397766
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102397766
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102397766
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102397766
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102397766
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102397766
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6
Other DBs
NCBI-GeneID: 102397766
NCBI-ProteinID: XP_025143921
LinkDB
Position
6
AA seq 250 aa
MEAGRLAHAIRLLLEYTDSNYEEKKYTMGDAPNYDRSQWLDEKFKLGLDFPNCLLEKEMA
PTPVLLPGKSHGWRSLLPYLIDGTHKLTQSNAILRHIARKHNMCGETEEENIRVDLLENQ
VMDVRLHMARICYSPDFEKLKPGYLKEIPGRMKLFSVFLGKRCWFAGNKLTYVDFLAYDI
LDLQRIFEPRCLDEFPNLKDFLTRFEALLVGNCPAGHLTVWGLKKISAYMKSSRFLPGPL
FMKLAVWGNK
NT seq 753 nt   +upstreamnt  +downstreamnt
atggaggccggcaggttggcccacgccatccgcctgctcctggagtacacagactcaaac
tatgaggaaaagaagtacacgatgggggacgctcccaactatgacagaagccagtggctg
gatgaaaaattcaagctgggcctggacttccccaattgtctgctggagaaggaaatggcc
cccactccagtactcttgcctggaaaatcccatggatggaggagcctgctgccctactta
attgatgggactcacaagctaacccagagcaatgccatccttcgccacattgctcgcaag
cacaacatgtgtggggagacagaagaggagaatattcgagtggacttattggagaaccag
gttatggatgtccgcttgcacatggccaggatctgctacagccctgactttgagaaactg
aaacctggttacttgaaggaaattcctggaaggatgaagctcttctcagtttttctgggg
aagaggtgttggtttgcagggaacaagctcacctatgtggatttcctggcttatgacatc
cttgatttgcaacgcatatttgagcccaggtgcctggatgaattcccaaacctgaaagat
ttcctcacccgttttgaggcactattggtgggcaactgccctgcgggtcacttaactgtt
tggggcctgaagaagatctctgcctacatgaagtccagccgcttcctcccaggccctctg
ttcatgaagcttgccgtgtggggcaacaagtag

KEGG   Bubalus bubalis (water buffalo): 102398085
Entry
102398085         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase Mu 1 isoform X5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102398085
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102398085
   00982 Drug metabolism - cytochrome P450
    102398085
   00983 Drug metabolism - other enzymes
    102398085
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102398085
   05204 Chemical carcinogenesis
    102398085
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102398085
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102398085
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102398085
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102398085
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102398085
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_N_3 GST_C_2
Other DBs
NCBI-GeneID: 102398085
NCBI-ProteinID: XP_006065043
LinkDB
Position
6
AA seq 218 aa
MTITLGYWDIRGLAHAIRLLLEYTDSNYEEKKYTMGDAPNYDRSQWLNEKFKLGLDFPNL
PYLIDGPHKLTQSKAILRYIARKHNMCGDTEEEKIRVDVLENQAMDTFNDLVMLCYNPEF
EKLKPQYLKEIPGKMKLYSEFLGRRPWFAGDKLTFVDFLVYDVLDVHRIFEPKCLDAFPN
LKDFISRFEGQKRISAYMKSSRFLPQPVYSKMAAWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgacgataaccctgggttactgggacatccgcgggctagcccatgccatccgcctgctc
ctggagtacacagactcaaactatgaggaaaagaagtacacgatgggggacgctcccaac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggacttccccaatttg
ccatacttaattgatggacctcacaagctcacccagagcaaggccatccttcgctacatt
gctcgcaagcacaacatgtgtggggacacagaggaggagaagattcgcgtggatgtattg
gagaaccaggctatggacacttttaatgacttggttatgctctgctacaaccctgaattt
gagaaactaaagcctcaatacttgaaggagatccctggaaagatgaagctctactcagag
tttctggggaggaggccttggtttgcaggggacaagctcacctttgtggatttcctggtt
tatgacgttcttgacgttcaccgcatatttgagcccaagtgcctggatgcattcccaaac
ctgaaagacttcatctctcgttttgagggccagaagaggatctctgcctacatgaagtcc
agccgcttcctcccacaacctgtatattcaaagatggctgcgtggggcaacaagtag

KEGG   Bubalus bubalis (water buffalo): 102399010
Entry
102399010         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase A2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102399010
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102399010
   00982 Drug metabolism - cytochrome P450
    102399010
   00983 Drug metabolism - other enzymes
    102399010
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102399010
   05204 Chemical carcinogenesis
    102399010
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102399010
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102399010
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102399010
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102399010
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102399010
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3
Other DBs
NCBI-GeneID: 102399010
NCBI-ProteinID: XP_006056836
LinkDB
Position
2
AA seq 223 aa
MAGKPKLHYFNGRGRMECIRWLLAAAGVEFEEKFIEQPEDLDKLRNDGSLMFQQVPMVEI
DGIKLVQTRAILNYVATKYNLYGKDMKERALIDMYSEGVADLGEMIMLLPLCPPDQKDAK
VAQIKERTTNRYFPAFEKVLKNHGQDYFVGNKLSKADIHLVELLYYVEELDPSLLANFPL
LKGLKARVSSLPAVKKFLQPGSQRKPPMDEKNLEETKRIFRIK
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcggggaaacccaagttacactacttcaatggacgtggcagaatggagtgcattcgg
tggctcctggctgcagccggagtggagtttgaagagaaatttatagaacaaccagaagac
ctggataagctaagaaacgatgggagtttgatgttccagcaagtgccgatggttgaaatt
gatgggataaagctggtgcagaccagagccattctcaactacgttgccaccaaatacaac
ctctatgggaaagacatgaaggagagagccctgattgatatgtactcagagggtgtggca
gatttgggtgaaatgatcatgcttttgccactatgcccacctgatcaaaaagatgctaaa
gtagctcagatcaaagagagaacaacaaaccgttatttccctgcatttgaaaaagtgctg
aagaatcacggacaagattattttgtgggcaacaagctgagcaaggctgacatccacctg
gttgaacttctctactatgtggaagagctggaccctagccttttggccaacttccctctg
ctgaagggcctgaaagccagagtcagcagtctcccggctgtgaagaagtttctgcagcct
ggcagccagaggaagcctcccatggatgagaaaaatttggaagaaacaaagaggattttc
aggattaaataa

KEGG   Bubalus bubalis (water buffalo): 102399334
Entry
102399334         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase A4-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102399334
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102399334
   00982 Drug metabolism - cytochrome P450
    102399334
   00983 Drug metabolism - other enzymes
    102399334
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102399334
   05204 Chemical carcinogenesis
    102399334
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102399334
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102399334
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102399334
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102399334
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102399334
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_3 GST_C_2 DUF2948
Other DBs
NCBI-GeneID: 102399334
NCBI-ProteinID: XP_006056837
LinkDB
Position
2
AA seq 222 aa
MAAKPKLWYFHGRGRMESIRWLLAAAGVEFEEEFLETREQYEKLQKDRRLLFGQVPLVEI
DGMELTQTRAILSYLAAKYNLQGKDPKETVRIDMYADGTLDLMLMVALAAFKPPEEKEES
LALVLKKAKTRYFPVFEKILKDHGEDFLVGNKFSWADIQLLEAILTMEELDASVLSDFPL
LKEFKTRISNIPTIKKFLQPGSQRKPPPDSHYVEVVRNILQF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcggccaaacccaagctctggtacttccacggccgaggcaggatggagtctatccgc
tggctgctggctgcagctggtgtggagtttgaagaagaatttcttgaaacaagagaacaa
tatgagaagttgcagaaggacagacgcctgcttttcggccaggtgcctctggttgaaatt
gatggaatggagctgacacagacaagagccatcctcagctaccttgctgccaagtacaac
ttgcaggggaaggacccgaaggagacagtcaggatcgacatgtacgccgacggcaccctg
gacctcatgctgatggtggcgctggctgcgttcaaacccccggaggaaaaagaggagagc
ctggctttagtcttgaagaaagctaaaacccggtacttccccgtctttgaaaagattttg
aaagaccacggagaggattttctcgttggcaacaaatttagctgggcagacatacagctc
ctggaagctattttaacaatggaagaacttgatgcttctgttctttccgatttccctctg
ctaaaggaatttaagacaagaatcagcaacattcctaccattaagaagttcctgcagcct
gggagtcagaggaagccgcccccggatagccactatgttgaggttgtcaggaacatcttg
cagttctaa

KEGG   Bubalus bubalis (water buffalo): 102399664
Entry
102399664         CDS       T05912                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutathione S-transferase A1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102399664
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102399664
   00982 Drug metabolism - cytochrome P450
    102399664
   00983 Drug metabolism - other enzymes
    102399664
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102399664
   05204 Chemical carcinogenesis
    102399664
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102399664
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102399664
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102399664
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102399664
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102399664
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C LolA_like GST_C_2
Other DBs
NCBI-GeneID: 102399664
NCBI-ProteinID: XP_006080960
LinkDB
Position
2
AA seq 222 aa
MAGKPKLHYFDARGKMEAIRWLLAAAGAEFEEKLIESXEDLDKLRYDGSLVFQQVPMVEI
DEMKLVQNRAILNYIATKYDLYGKDMKERALIDMYTEDVADLSEMIMLLPLCPPDQKNTK
LTLVRERTTNRYLPAFEKVLKSHRQDYLVGNKLSKADIHLVELLYYEEELDPSLLANFPL
LKGLKTKVSNLPAVKKFLQPGSQRKPPGAEKSLEQARKIFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcaggaaagcccaagcttcactatttcgatgcccgaggcaagatggaggccatccgg
tggctcctggctgcagctggagcggagtttgaagagaaacttatagaaagttaagaagat
ttggataagttaagatatgatgggagtttagtgttccagcaagtgccaatggttgaaatt
gatgagatgaagctggtacagaacagagccattctcaactacattgccaccaaatatgat
ctctatgggaaagacatgaaggagagagccctgattgatatgtacacagaggatgtggca
gacttgagtgaaatgatcatgcttttgccactgtgcccacctgatcaaaaaaataccaag
ttgaccctggtccgagagaggacaacaaaccgttatctccctgcatttgaaaaagtgctg
aagagccacagacaagactatcttgtgggcaacaagctgagcaaggctgacatccacctg
gttgaattgctctattatgaggaagagctagaccccagtcttttggccaacttccctctg
ctgaagggcctgaaaaccaaagtcagcaatctcccggccgtgaagaagtttctgcagcct
ggcagccagaggaagcctccgggggccgagaaaagtcttgaacaagccagaaagattttc
aagttttaa

KEGG   Bubalus bubalis (water buffalo): 102399985
Entry
102399985         CDS       T05912                                 

Gene name
GSTA4
Definition
(RefSeq) glutathione S-transferase A4 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102399985 (GSTA4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102399985 (GSTA4)
   00982 Drug metabolism - cytochrome P450
    102399985 (GSTA4)
   00983 Drug metabolism - other enzymes
    102399985 (GSTA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102399985 (GSTA4)
   05204 Chemical carcinogenesis
    102399985 (GSTA4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102399985 (GSTA4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102399985 (GSTA4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102399985 (GSTA4)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102399985 (GSTA4)
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102399985 (GSTA4)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 102399985
NCBI-ProteinID: XP_006056838
LinkDB
Position
2
AA seq 222 aa
MATKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADKHHLFGKDLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VANMAQKAIIRYFPVFEKVLRGHGQRFLVGNQLSLADIILLQTILALEEKIPNILSAFPH
LQEYTVKISNIPTIKKFLEPGSKKKPPPDDIYVRTVYNIFMP
NT seq 669 nt   +upstreamnt  +downstreamnt
atggccacgaaacccaagctccactatcccaacggacgaggccggatggaatctgtgcga
tgggtgttagctgctgccggagtcgagtttgacgaagaatttttagaaacaaaagaacag
ttgcagaagttgcaggatggtaaccacctgctgtttcagcaagtgccaatggttgaaatt
gacgggatgaagctggtgcagacccggagcatcctccactacatcgcagacaagcaccat
ctctttggcaaagacctcaaggagagaaccctgattgacatgtatgtggaggggaccctg
gatcttctggaactgcttatcatgcatcctttcctcaaaccagacgatcagcaaaaggaa
gtggctaatatggcccagaaggctataattagatactttcctgtgttcgaaaaggtttta
cggggtcatggacaaaggtttcttgttggtaatcagctgagtcttgcagacataattcta
ctccagaccattttggctctagaagagaaaattcctaatatcctgtctgccttccctcac
ctccaggagtacacagtgaaaatcagtaatatccctacaattaagaagttccttgaacct
ggcagcaagaagaaacctcctcccgatgacatctacgtgagaaccgtgtacaacatcttc
atgccatag

KEGG   Bubalus bubalis (water buffalo): 102400334
Entry
102400334         CDS       T05912                                 

Gene name
MGST1
Definition
(RefSeq) LOW QUALITY PROTEIN: microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102400334 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102400334 (MGST1)
   00982 Drug metabolism - cytochrome P450
    102400334 (MGST1)
   00983 Drug metabolism - other enzymes
    102400334 (MGST1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102400334 (MGST1)
   05204 Chemical carcinogenesis
    102400334 (MGST1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102400334 (MGST1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102400334 (MGST1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102400334 (MGST1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102400334 (MGST1)
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102400334 (MGST1)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 102400334
NCBI-ProteinID: XP_006080632
LinkDB
Position
4
AA seq 155 aa
MASLSQLMENEVFMAFASYTTIVLSKMMFMSTATAFYRLTRKVFVNPEDCLGFGKGENAK
KYLRTDDRVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALAFFIGYGVTLSMAYRLLKSKLYL
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccagcctttcgcagctaatggagaatgaagtattcatggcctttgcctcctacacg
acgattgtgctttcaaaaatgatgtttatgagcactgcaactgcattctatagattgaca
agaaaggtttttgtcaacccagaagactgcctgggcttcggcaaaggagaaaatgccaag
aagtatcttcggacagatgacagggtggaacgtgttcgaagagcccacttgaatgacctt
gaaaacattgtgccatttcttggtattggccttctgtattccttgagtggtccagacctc
tctacagccatcctgcacttcagactctttgtcggagcacgaatctaccacacaattgcg
tatttgacaccccttccccagccaaatcgcgctttggcttttttcattggctatggagtt
acactttcaatggcttacagattgctgaagagtaaactgtacctgtaa

KEGG   Bubalus bubalis (water buffalo): 102402147
Entry
102402147         CDS       T05912                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102402147 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102402147 (MGST3)
   00982 Drug metabolism - cytochrome P450
    102402147 (MGST3)
   00983 Drug metabolism - other enzymes
    102402147 (MGST3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102402147 (MGST3)
   05204 Chemical carcinogenesis
    102402147 (MGST3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102402147 (MGST3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102402147 (MGST3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102402147 (MGST3)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102402147 (MGST3)
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102402147 (MGST3)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 102402147
NCBI-ProteinID: XP_006057350
LinkDB
Position
6
AA seq 152 aa
MAVLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSSDPENGHIFNCIQRA
HQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPRKRQRGALSFI
ALIGLMGTTVCSAFQHLGWVRTGLNSGCKSCH
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccgtcctctctaaggaatatggtttcgtgattctaactggtgctgccagcttcttg
atggtaactcatctagccatcaatgtttccaaggcccgcaagaagtacaaagtggagtac
cctaccatgtacagcagcgaccctgaaaacgggcacatcttcaactgcattcagcgagct
caccagaacacgttggaagtgtaccctcccttcttattttttctagctgttggaggtgtt
taccacccacgcatagtttctggcttgggcttggcctggatcgttggacgagtcctttat
gcttacggctattacacaggagaacccagaaagcggcagcggggagccctgagcttcatc
gccctcattggcctgatgggcaccactgtgtgctctgccttccagcatcttggttgggtt
agaaccggcttgaacagcgggtgcaaaagctgccattga

KEGG   Bubalus bubalis (water buffalo): 102402218
Entry
102402218         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase theta-3 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102402218
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102402218
   00982 Drug metabolism - cytochrome P450
    102402218
   00983 Drug metabolism - other enzymes
    102402218
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102402218
   05204 Chemical carcinogenesis
    102402218
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102402218
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102402218
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102402218
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102402218
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102402218
SSDB
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4
Other DBs
NCBI-GeneID: 102402218
NCBI-ProteinID: XP_006048173
LinkDB
Position
17
AA seq 239 aa
MGLELYLDLLSQPCRAVYIFAKKNSIPFELRSVDLLKGQNHSDDFVQVNPLKKVPALKDG
DFTLAESVAILLYLARKYEAPDHWYPQDLQARARVDEYLSWQHTALRMSCTRAMWQKMMF
PIFLGQRVPPETLANTLAELDRCLQLLEDKFLKDQDFLAGPHISVADLVAITELMHPVSA
GCDIFRSRPKLAAWRQRVEAAVGEDLFREAHAVLMKAKDLPPADTAVKERLKPLAQLFL
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggcctggagctctatctggacctgctgtcccagccctgccgcgccgtctacatcttc
gccaagaagaacagcatcccctttgagctgcgctccgtggacctgctcaaaggccagaac
cacagcgatgactttgtccaggtgaaccccctgaagaaggtgccagccctgaaagatggg
gatttcaccttggctgagagtgtggccatcctgctgtatctggcccgcaagtacgaggcc
cctgaccactggtacccccaggacctgcaggcccgagcccgtgtggacgagtacctgtcg
tggcagcacacagccctccggatgagctgcacccgggccatgtggcagaagatgatgttc
cccatattcctgggccaacgcgtgccccctgagacactggcgaacactctggccgagctg
gacaggtgcctgcaactgcttgaggacaagttcctgaaggaccaggacttcctggccggg
ccccacatctcagtggcggacttggtggccatcacagagctgatgcatcctgtcagcgcc
ggttgtgacatcttcagaagccggcctaagctggccgcgtggcgccagcgcgtggaagct
gcggtgggggaggacctcttccgagaggcccatgcggtcctcatgaaggccaaggacctg
cctccagcagacactgccgtgaaggagaggctgaagcccttagcgcagctgttcttgtag

KEGG   Bubalus bubalis (water buffalo): 102402536
Entry
102402536         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase theta-1 isoform X3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102402536
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102402536
   00982 Drug metabolism - cytochrome P450
    102402536
   00983 Drug metabolism - other enzymes
    102402536
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102402536
   05204 Chemical carcinogenesis
    102402536
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102402536
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102402536
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102402536
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102402536
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102402536
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Other DBs
NCBI-GeneID: 102402536
NCBI-ProteinID: XP_006048174
LinkDB
Position
17
AA seq 240 aa
MGLELYLDLLSQPCRAIYIFAKKNRIPFELRTVDLRKGQHLSDAFAQVNPLQKVPVLKDG
DFILTESVAILLYLARKYKVPDHWYPQDLQACARVDEYLAWQHTALRRNCLRALWHKVML
PVFLGEPVSPEMLATTLAELDMALQVLEGKFLQDKAFLTGPHISLADLVAITELMHPVGA
GCQVFKGRPKLAAWRQRVEAAVGEVLFQEAHEVILKAKDSQPADSTLKQKMLPKVLAMIQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtcccaaccctgccgcgccatctacatcttc
gccaagaagaaccgcatccccttcgagctgcgcaccgtggacctgcgcaaaggccagcac
ctcagtgatgcctttgcccaggtgaaccccctgcagaaggtgccagtcttgaaggacggg
gacttcatcttgaccgagagcgtggccatcctgctctacctggcccgcaagtataaggtc
cccgaccactggtaccctcaggacctgcaggcctgtgcccgtgtggacgagtacctggcc
tggcagcacacagccctgcggagaaactgcctccgagccctgtggcataaggtgatgctc
cctgttttcctgggtgagccggtctctcctgagatgctggcgaccacgctggcagagttg
gacatggccctgcaggtgcttgagggcaagttcctccaggacaaagcctttcttaccggg
ccccacatctctctggctgacctggtagccatcacggagctgatgcaccccgtgggtgcc
ggctgccaagtcttcaaaggccgacccaagctggccgcatggcgccagcgcgtggaggcg
gcggtgggggaggtcctcttccaggaggcccatgaggtcatcctgaaggccaaggactct
cagcctgcagactccaccttaaagcagaagatgctgcccaaagtgctggccatgatccag
tga

KEGG   Bubalus bubalis (water buffalo): 102403194
Entry
102403194         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase theta-4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102403194
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102403194
   00982 Drug metabolism - cytochrome P450
    102403194
   00983 Drug metabolism - other enzymes
    102403194
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102403194
   05204 Chemical carcinogenesis
    102403194
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102403194
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102403194
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102403194
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102403194
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102403194
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2
Other DBs
NCBI-GeneID: 102403194
NCBI-ProteinID: XP_006048176
LinkDB
Position
17
AA seq 241 aa
MGLELYLDLLSASCRAVYIFARKNSIPFDFQFVDLLKGHHHSTEYIEINPLRKLPSLRDG
KFILSESVAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQLPMNKILWMKLLI
PMITGDEVPAEKTEQMLAEVKNNLKLFEEKFLQDKMFITGDNISLADLVALVEMMQPMAG
NHNVFLNSAKLAEWRMRVELAIGSTLFCEAHDRLVKLAEWDCSTLDPMVKERICDLLQKF
K
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtccgcatcctgccgcgccgtctacatcttc
gccaggaagaacagcatccccttcgacttccagtttgtggatctgctgaaaggtcaccac
cacagcacggagtacatcgagatcaaccccctgaggaagctgcccagcctcagagacggg
aagttcatcttgtctgaaagcgtggccatccttttctacctgtgccgcaagtacagcgcc
ccctcgcactggtacccgccagacctgcacatgcgtgcccgcgtggacgagttcatggcc
tggcagcacacggccattcagctgcccatgaacaagatactctggatgaagctgctgatc
ccgatgatcacgggagatgaggtcccagctgagaagacagagcagatgctggcggaggtg
aagaacaacctgaagctcttcgaggagaagtttctgcaggacaagatgttcatcactggg
gacaacatctccctggccgacctggtagccctggtggagatgatgcagcccatggccggc
aaccataacgtcttcctcaacagtgccaagctggccgagtggcgcatgagggtggagctg
gccatcggctccactctcttctgcgaggcccacgaccggctggtgaagttggcggaatgg
gactgctccacgctggacccgatggtcaaggagaggatctgcgatttgctgcagaagttc
aagtag

KEGG   Bubalus bubalis (water buffalo): 102404824
Entry
102404824         CDS       T05912                                 

Gene name
HPGDS
Definition
(RefSeq) hematopoietic prostaglandin D synthase isoform X1
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00590  Arachidonic acid metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102404824 (HPGDS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102404824 (HPGDS)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102404824 (HPGDS)
   00982 Drug metabolism - cytochrome P450
    102404824 (HPGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102404824 (HPGDS)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102404824 (HPGDS)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     102404824 (HPGDS)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_N_3 GST_C GST_N_2 GST_C_6 GST_N_4
Other DBs
NCBI-GeneID: 102404824
NCBI-ProteinID: XP_025146189
LinkDB
Position
7
AA seq 199 aa
MPNYKLIYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPEIKSTLPFGKIPILEVDGLY
LHQSLAIARYLTRNTDLAGKTELEQCQVDAIVDTLDDFMSRFPWAEKRQDIKNQIFKELL
TCDAPPLLQNLDTYLGENEWLIGDSVTWADFYWEICSTTLLVFKPDLLDIHPRLVTLRKK
VQSIPAIADWILRRPQTKL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgccaaactacaaactcatttattttaacatgagggggagagcagaaattattcgttat
atatttgcatatttggacataaaatatgaagaccacagaatagaacaagctgattggcct
gaaatcaagtcaactcttccatttggcaaaatccccattttggaagttgacggactttac
cttcaccagagtctagcaatagcaagatacttgaccagaaacacagatttggctggaaaa
acagaacttgaacaatgtcaagtggatgcaattgtggacacactggatgatttcatgtct
cgttttccttgggcagagaaaagacaagatataaaaaatcagatatttaaggagctactt
acatgtgatgcacctcctcttctgcaaaatttggacacatacttaggggaaaacgagtgg
cttattggtgactctgtaacttgggcagacttctactgggaaatttgcagtaccacactt
ttggtctttaaacccgatttgctggacatccaccccaggctggtgacattacggaagaaa
gttcaaagcattcctgccatcgctgactggatactgcgaaggccccagaccaaactctag

KEGG   Bubalus bubalis (water buffalo): 102409242
Entry
102409242         CDS       T05912                                 

Gene name
GSTK1
Definition
(RefSeq) glutathione S-transferase kappa 1 isoform X2
  KO
K13299  glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub04146  Peroxisome
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102409242 (GSTK1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102409242 (GSTK1)
   00982 Drug metabolism - cytochrome P450
    102409242 (GSTK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102409242 (GSTK1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102409242 (GSTK1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102409242 (GSTK1)
SSDB
Motif
Pfam: DSBA Helicase_C_3 Nif11 EAL
Other DBs
NCBI-GeneID: 102409242
NCBI-ProteinID: XP_006071939
LinkDB
Position
8
AA seq 226 aa
MQPVPRTLELFYDVLSPYSWLAFEVLCRYKNIWNISLQLQPTLIGGIMRDSGNQPPAMLP
RKAVYLRSDVRLLSQHHQVPIHFPKDFFSVILKKGSLTAMRFLTAVKMEHPELLEKVSRE
LWMRVWSRDEDITEPPSILAAAEKAGMSMEQAQELLEKVSTPQVKNQLKETTEAACKYGA
FGLPVTVAHLHDETHMLFGSDRMELLAHLLGEKWMGPVPPAVNAKL
NT seq 681 nt   +upstreamnt  +downstreamnt
atgcagcccgttccccgaacgctcgagctgttctacgatgtcctgtccccctactcctgg
ctggccttcgaggtcctgtgccgatataagaatatctggaacatcagcctgcagctgcag
ccgacgttaattggagggatcatgagagacagcggaaaccagccgccagctatgcttccc
cgcaaagccgtatacttgagaagtgacgttaggctcctgagccagcatcaccaggttccc
atccacttccccaaggatttcttctctgtgattcttaagaaaggaagtttgacagccatg
cgcttcctcactgcggtgaagatggagcacccggagctactggagaaagtgtccagagaa
ctgtggatgcgcgtctggtcacgggatgaagacatcacggagcccccgagcatcctggct
gctgcagagaaggctggcatgtccatggaacaagcccaggaacttctagaaaaggtctca
acaccacaagtgaagaaccagctcaaggagaccactgaggcagcctgcaaatatggtgct
tttgggctgcccgtcactgtggcccacctgcatgatgaaacccacatgctctttggctcc
gaccgaatggagttgctggcgcacctgctgggagaaaagtggatgggccctgtgcctcca
gctgtaaacgccaaactttaa

KEGG   Bubalus bubalis (water buffalo): 102412117
Entry
102412117         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase omega-1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102412117
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102412117
   00982 Drug metabolism - cytochrome P450
    102412117
   00983 Drug metabolism - other enzymes
    102412117
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102412117
   05204 Chemical carcinogenesis
    102412117
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102412117
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102412117
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102412117
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102412117
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102412117
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 102412117
NCBI-ProteinID: XP_006050153
LinkDB
Position
23
AA seq 241 aa
MSGGTVRSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLRAKGIRHEVININLKNKP
EWFFKKNPLGLVPVLETSLGQLIYESAITCEYLDEAYPGKKLLPGDPYEKACQKMVFESF
SKVPSLMVSFLRKQNKEDCSGLEEELHKEFSKLEEVLTNKKTTFFGGNSLSMIDYLIWPW
FEWLEALELNEYVEHTPNLKLWMASMKNDPIVSSLPTDVKTLQGFFNLYLQNSPEACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggcggaacggtcagaagcctggggaagggaagcgcgcccccggggcccgtcccc
gagggcctgatccgtgtctacagcatgaggttctgtccttacgccaagaggacgctcctg
gtcctgagggccaagggaatccggcatgaagtcatcaacatcaacctgaaaaataagcct
gagtggtttttcaagaagaatcccttaggcctagtgccggttctggaaaccagtctgggt
cagttgatctatgaatctgccatcacttgtgagtacctggatgaagcatatccagggaag
aagctgttgccaggcgacccctatgagaaagcttgccaaaagatggtctttgagtccttt
tctaaggtaccatctttgatggtaagctttcttagaaagcaaaataaggaagattgctct
ggcctagaagaagaactgcataaagaattcagcaagctggaggaggttctgactaataag
aagacaaccttctttggtggcaattctctttctatgattgattacctcatctggccctgg
tttgaatggctagaagccttggagttaaatgagtatgtagagcacactccaaatctaaag
ctctggatggcatccatgaagaatgatcccatagtatcatccctccccaccgatgtgaag
acccttcaaggtttcttcaacctctacttgcagaacagccccgaggcctgtgactatggt
ctctga

KEGG   Bubalus bubalis (water buffalo): 102412874
Entry
102412874         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102412874
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102412874
   00982 Drug metabolism - cytochrome P450
    102412874
   00983 Drug metabolism - other enzymes
    102412874
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102412874
   05204 Chemical carcinogenesis
    102412874
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102412874
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102412874
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102412874
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102412874
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102412874
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5
Other DBs
NCBI-GeneID: 102412874
NCBI-ProteinID: XP_006050156
LinkDB
Position
23
AA seq 241 aa
MSGGSARSLGKGSDPPGPVPEGLIRVYSMRFCPYAQRTRLVLTAKGIRHEVININLKNKP
EWFFKKNPSGLVPVLETSQGQLICESAITCEYLDEAYPEKKLLPGDPYEKACQKMVLESF
SKVPLLISRILRTQNKEDCSGLKEELHKEITKLEEVLTDKKTTFFGGSSLSMIDYLIWPW
FERLEALELNECVDHAPTLKLWMAAMKKDPTVSSLLTDVKTFQGFFNLYLQNSPEACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggaggatcagctaggagcctgggcaagggaagcgaccccccggggcccgtcccc
gagggcctgatccgtgtctacagcatgaggttctgcccgtatgcccagaggactcgcctg
gtcctgacggccaagggtatccggcatgaagtcatcaacatcaacctgaaaaataagcct
gagtggttcttcaagaagaatccctcaggcctggtgccggttctggaaaccagtcagggt
caattgatctgtgaatctgccatcacttgtgagtacctggatgaagcatatccagagaag
aagctgttgccaggtgacccctatgagaaagcttgccaaaagatggtcttggagtccttt
tctaaggtaccacttttgatatcgaggattcttagaacacaaaataaggaagactgctct
ggcctaaaagaagaattgcataaagaaatcaccaagctagaggaggttctgactgataag
aagacaaccttctttggtggcagttctctttctatgattgattacctcatctggccctgg
tttgaacggctggaagctctggagttgaatgagtgcgtagaccacgctccaactcttaag
ctgtggatggcagccatgaagaaggatcccacagtatcatctctcctcactgatgtgaag
acctttcaaggtttcttcaacctctacttgcagaacagccctgaggcttgtgactatgga
ctctga

KEGG   Bubalus bubalis (water buffalo): 102413434
Entry
102413434         CDS       T05912                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102413434 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102413434 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    102413434 (GSTO2)
   00983 Drug metabolism - other enzymes
    102413434 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102413434 (GSTO2)
   05204 Chemical carcinogenesis
    102413434 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102413434 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102413434 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102413434 (GSTO2)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102413434 (GSTO2)
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102413434 (GSTO2)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Other DBs
NCBI-GeneID: 102413434
NCBI-ProteinID: XP_006050158
LinkDB
Position
23
AA seq 244 aa
MTDDATRTLGKGSIPPGPVPEGVIRLYSMRFCPYAHRTRLVLRAKGIRHEVININLRNKP
EWYFTKHPFGQIPVLENSKCQLIYESVIACEYLDDAYPGRKLYPYDPYERARQKMLLELF
YKVPHLTKECLVALRCGRDCADLKLALRQEFCNLEEILGYQNTVFFGGDCISMIDYLFWP
WFERLEVYGIADCVNHTPTLRLWIAAMKQDPTVCSLLTDKNTFLGFLNLYFQNNPGAFDY
GLSC
NT seq 735 nt   +upstreamnt  +downstreamnt
atgactgacgacgcgaccaggaccttggggaaagggagcatccccccagggccggtccct
gaaggcgtaatccgcctctacagcatgaggttctgtccgtacgcgcacaggacgcgcctg
gtcctccgggccaaaggcatcagacatgaagttatcaacattaacctgagaaacaagcct
gaatggtattttacaaagcatccttttggccaaattcctgtcctggagaacagcaaatgt
caactgatctatgaatctgtcatcgcttgtgagtacctggatgacgcttaccctggaagg
aagctgtacccatatgacccttacgagcgagctcgccaaaagatgttattggagctgttc
tataaggtcccacatttgaccaaggagtgtctggtagcattgagatgcgggagagactgc
gctgatctgaagctggccctgcgtcaggagttctgcaacctggaagagattcttggctat
cagaacaccgtcttctttggcggagattgtatatccatgattgattacctcttttggccc
tggtttgagcggctggaagtatatggaatagccgactgtgtgaaccacacccccacgctc
cggctctggattgcagccatgaagcaggatcccacagtctgttctctgctcacagataag
aacaccttcctgggcttcttgaatctctattttcagaacaaccccggtgcctttgactac
gggctaagttgctga

KEGG   Bubalus bubalis (water buffalo): 102413809
Entry
102413809         CDS       T05912                                 

Gene name
GSTA1
Definition
(RefSeq) glutathione S-transferase A1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102413809 (GSTA1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102413809 (GSTA1)
   00982 Drug metabolism - cytochrome P450
    102413809 (GSTA1)
   00983 Drug metabolism - other enzymes
    102413809 (GSTA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102413809 (GSTA1)
   05204 Chemical carcinogenesis
    102413809 (GSTA1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102413809 (GSTA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102413809 (GSTA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102413809 (GSTA1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102413809 (GSTA1)
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   102413809 (GSTA1)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Other DBs
NCBI-GeneID: 102413809
NCBI-ProteinID: XP_025124129
LinkDB
Position
2
AA seq 222 aa
MAGKPTLHYFNGRGRMECIRWLLAAAGVEFEEKFIEKPEDLDKLKNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDIKERALIDMYSEGVADLGEMIMHFPLCPPAEKDAK
LTLIREKTTNRYLPAFENVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDPSLLANFPL
LKALKARVSNIPAVKKFLQPGSQRKPPADEKKIEEARKVFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagggaagcccactcttcactatttcaatggacgcggcagaatggagtgcattcgg
tggctcctggctgcagctggagtggagtttgaagagaaatttatagaaaaaccagaagac
ttggataaattaaaaaatgatgggagtttgatgttccagcaagtgccaatggttgaaatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac
ctctacgggaaagatataaaggagagagccctgattgatatgtattcagagggtgtggca
gatttgggtgaaatgatcatgcattttccactgtgcccacctgctgaaaaagatgccaag
ctgaccctaattcgagagaagacaacaaaccgttatctccctgcatttgaaaatgtgctg
aagagccatggacaagactacctggtgggcaacaagctgagcagggctgacatccacctg
gttgaacttctctactatgtggaagagctggaccccagccttttggccaacttccctctg
ctgaaggccctaaaagccagagtcagcaatatcccggccgtgaagaaatttctgcagcct
ggcagccagaggaagcctcccgcggatgagaaaaaaatagaagaagccaggaaggttttc
aagttttag

KEGG   Bubalus bubalis (water buffalo): 112580184
Entry
112580184         CDS       T05912                                 

Definition
(RefSeq) glutathione S-transferase A1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01524  Platinum drug resistance
bbub05200  Pathways in cancer
bbub05204  Chemical carcinogenesis
bbub05225  Hepatocellular carcinoma
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112580184
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112580184
   00982 Drug metabolism - cytochrome P450
    112580184
   00983 Drug metabolism - other enzymes
    112580184
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112580184
   05204 Chemical carcinogenesis
    112580184
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112580184
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112580184
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112580184
Enzymes [BR:bbub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112580184
Transporters [BR:bbub02000]
 Other transporters
  Pores ion channels [TC:1]
   112580184
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Other DBs
NCBI-GeneID: 112580184
NCBI-ProteinID: XP_025124179
LinkDB
Position
2
AA seq 222 aa
MAGKPTLHYFNGRGRMECIRWLLAAAGVEFEEKFIEKPEDLDKLKNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDIKERALIDMYSEGVADLGEMIMHFPLCPPAEKDAK
LTLIREKTTNRYLPAFENVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDPSLLANFPL
LKALKARVSNIPAVKKFLQPGSQRKPPADEKKIEEARKVFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagggaagcccactcttcactatttcaatggacgcggcagaatggagtgcattcgg
tggctcctggctgcagctggagtggagtttgaagagaaatttatagaaaaaccagaagac
ttggataaattaaaaaatgatgggagtttgatgttccagcaagtgccaatggttgaaatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac
ctctacgggaaagatataaaggagagagccctgattgatatgtattcagagggtgtggca
gatttgggtgaaatgatcatgcattttccactgtgcccacctgctgaaaaagatgccaag
ctgaccctaatccgagagaagacaacaaaccgttatctccctgcatttgaaaatgtgctg
aagagccatggacaagactacctggtgggcaacaagctgagcagggctgacatccacctg
gttgaacttctctactatgtggaagagctggaccccagccttttggccaacttccctctg
ctgaaggccctaaaagccagagtcagcaatatcccggccgtgaagaaatttctgcagcct
ggcagccagaggaagcctcccgcggatgagaaaaaaatagaagaagccaggaaggttttc
aagttttag

DBGET integrated database retrieval system