KEGG   Bubalus bubalis (water buffalo): 102392295
Entry
102392295         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-1 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102392295
   00053 Ascorbate and aldarate metabolism
    102392295
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102392295
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102392295
   00860 Porphyrin and chlorophyll metabolism
    102392295
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102392295
   00982 Drug metabolism - cytochrome P450
    102392295
   00983 Drug metabolism - other enzymes
    102392295
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102392295
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102392295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102392295
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102392295
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102392295
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 102392295
NCBI-ProteinID: XP_006053795
LinkDB
Position
6
AA seq 528 aa
MTAGSQGECPVILLLLLCALCPSVSRGGKLLVVPVDGSHWLSLIGPLQPLQQKGHDIVVL
APNVSVYIKEEAFYTLKRYPVPFRREDLEEIFISLGRTVFEDEPFLKRVIKTYQKIKKDS
ALILSACSHLLRNKELMASLTASSFDAVLTDPFLPCGPIVAQYLSVPAVFFLNGLPCSLD
FQGTQSPSPPSYVPRYLSFNSDHMTFLQRVKNMFITLSESLLCDMVYSPYGLLASEILQK
DITVRDLMSFGSVWILRSDFVFNFPRPIMPNIVFVGGINCASKKPLSQEFEAYVNASGEH
GIVVFSLGSMVSEIPEQKAMEIADALGKIPQTVLWRYTGTPPPNLAKNTKLVKWLPQNDL
LGHPKTRAFITHSGSHGIYEGICNGIPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMSS
EDLENALKAVINEKSYKENIMRLSRLHKDRPIEPLDLAVFWVEFVMRHKGASHLRPAAHD
LTWYQYHSLDVIGFLLAVTLTVIFVTFKACAFAFRKCFGKKSHKSKTH
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgacagcagggtcccagggggaatgcccagtcatcctgctcctgctgctgtgcgcactc
tgcccctccgtgtcccggggtgggaagctgctggtggtcccggtagatggcagccactgg
ctgagtttgatcggacctctccagccactgcagcagaagggacatgacatagtggtcctg
gcacctaacgtctccgtatacattaaagaggaagcattttacaccttgaagaggtaccct
gtgccattccgaagggaggacttggaagagatttttatcagcctcgggcgtactgttttt
gaggatgagcctttcctgaagcgcgtgatcaaaacctaccagaaaataaaaaaggactcg
gctctgatcttatccgcctgctcccacttactgcgcaacaaggagctgatggcctccctg
actgcaagtagcttcgatgccgtgttgacagaccctttccttccctgtggccccatcgtg
gcccagtacctgtctgtgcctgccgtgttcttcttgaatggactgccatgcagcctggac
tttcagggtacccagagccccagtccaccatcctacgtgcccaggtatctgtcctttaac
tcagatcacatgaccttcctgcagcgggtgaagaacatgttcatcaccttgtcagagagt
ttgctgtgcgatatggtttattccccgtatgggctgcttgcctcggaaatccttcagaaa
gacatcactgttcgggatctcatgagttttgggtctgtctggattctcagaagtgacttt
gtgtttaatttcccgagacccatcatgcccaacatagtttttgttggtgggatcaactgc
gctagcaaaaagccactctctcaggaatttgaagcctatgtaaatgcttctggagaacat
ggaattgtggttttctctttgggctcaatggtctcggagattccggagcagaaagctatg
gaaattgctgatgctttgggcaaaatacctcaaacagtcctgtggcggtacactgggact
ccaccaccgaaccttgcgaagaataccaagctcgtcaagtggctgccccagaacgatctg
cttggtcacccaaagactcgggcctttatcacacattccggctcccatggcatttatgaa
ggaatatgcaatggcattcccatggtgatgatgcccttgtttggtgatcagatggacaat
gcaaagcgcatggagacccggggagctggagtgactttgaatgtcctggaaatgagttcg
gaagatttagaaaatgccttgaaagctgtcatcaatgaaaagagctataaggaaaacatc
atgcgcctctccagacttcacaaggaccgccccatagagcctctggacctggctgtattc
tgggtggagtttgtgatgaggcacaagggggcatcccacctgcgccctgcagcccatgac
ctcacctggtaccagtaccactctctggatgtgattggcttcctcctggcggtcacgctg
acagtcatcttcgtcacctttaaggcctgtgccttcgccttccggaaatgctttgggaag
aaatctcataaatccaagacacactga

KEGG   Bubalus bubalis (water buffalo): 102396388
Entry
102396388         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-9-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102396388
   00053 Ascorbate and aldarate metabolism
    102396388
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102396388
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102396388
   00860 Porphyrin and chlorophyll metabolism
    102396388
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102396388
   00982 Drug metabolism - cytochrome P450
    102396388
   00983 Drug metabolism - other enzymes
    102396388
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102396388
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102396388
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102396388
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102396388
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102396388
SSDB
Motif
Pfam: UDPGT Glyco_trans_4_2 Glyco_transf_4 ArsR
Other DBs
NCBI-GeneID: 102396388
NCBI-ProteinID: XP_025144974
LinkDB
Position
6
AA seq 332 aa
MAPAMLMGFFPLCVCLLLTPGFAEAGKLLVVPMDGSHWFTMRSVVEKLSQRGHEVVLVIP
EVSWHLSNSSNITVKTYHTAYTLEDLNVEFRKFSDFQWKVRPQSLLPMLMGSANTIFDYF
FSRCKSLFEDKKLVKYLEESSFDAVFLDPFDMCGLIIAKYLSLPPVIFTRGVFCHYFEEG
TQSPMALSYVPRAILAFSDAMTFEQRVWNLIRYLEERLFCRYFYKNVEEIASEILQMPVT
TSELFSQTSIWLLRNDFVLDYPRPVMPNMVFIGGINCQELNQKPLSEVSIESLLCTWLRA
GDVAPTNEHDCLLEAAVQWGAGIDQLQMMKSM
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctcctgcaatgttaatgggcttctttcctctgtgtgtgtgtctgctgctgacacca
ggcttcgccgaggcaggcaagctgctggtggtacccatggatgggagccactggtttacc
atgcgttcagtggtggagaaactctcccaaagggggcatgaggtggtcctagtcatacca
gaggtgagttggcacctgagcaattcatccaatattacggtaaagacttatcatacggct
tacactctggaggatttgaacgtggagttccggaagttctctgattttcagtggaaagtt
cggccacagagtctacttcctatgttaatgggctcagccaacacaatttttgattacttt
ttttcacgttgtaagagcttgtttgaggacaaaaaattagtaaaatacttagaagagagt
tcttttgatgcagtgtttctagatccttttgatatgtgtggtttgattatagccaagtat
ctctcacttccacctgtgatcttcaccagaggagttttctgccattattttgaagaaggc
actcagagtcccatggccctttcttatgttccgagagctattttggcattctctgatgcc
atgacttttgagcagagagtgtggaatcttatccggtacttagaggaacgtttattttgc
cgctatttttacaaaaatgttgaagaaattgcctctgagattctccagatgcctgtcaca
acgtctgagctcttcagtcaaacatcaatttggttgttacgaaatgactttgttttggac
tatcccagaccagtgatgcccaacatggtcttcattggtggcatcaactgtcaggagttg
aatcaaaagccactgtcagaggtatctattgagagtcttctatgtacctggttaagagct
ggggacgtggcaccaacaaatgaacatgactgcctgctggaagctgccgtccaatgggga
gcaggtattgatcagttacaaatgatgaaaagcatgtga

KEGG   Bubalus bubalis (water buffalo): 102398161
Entry
102398161         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102398161
   00053 Ascorbate and aldarate metabolism
    102398161
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102398161
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102398161
   00860 Porphyrin and chlorophyll metabolism
    102398161
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102398161
   00982 Drug metabolism - cytochrome P450
    102398161
   00983 Drug metabolism - other enzymes
    102398161
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102398161
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102398161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102398161
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102398161
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102398161
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 102398161
NCBI-ProteinID: XP_006080234
LinkDB
Position
7
AA seq 529 aa
MKTVKVFCILFVLHLCLLDSGRTGKVLVWPVDFSHWINLQVILEELHLRGHEITVLVPSQ
SLLIDHTKIPYHVEILRLSVTEETFMEELNTILYEATFELPKLSWWEMQTKLANLGRRFL
LTNRRVCDSAITNKGLLSRLQAAKFDVCIADPLSFCGELVAELLNIPFIYTFRLFYGNVI
ERLCAGLPMPSSYVPGVTSRLTDKMTFRQRLENWLLYTVSDMIYSYYIFPEWDEYYSKVL
GKPTTLCEIMGKADMWLFRSYWDFEFPQPYLPNTEFVGGLHCKPAKPLPKEFEEFVQSSG
KDGVVVFTLGSMIKNLSEEKSNMIASALAQIPQKVLWRYTGKKPETLGANTRLYKWIPQN
DLLGHPKTRAFITHCGTNGIYEAIYHGVPIVGIPMFGDQHDNVARMKAKGAAVDVDLQRM
TSADLLNALKAVINNPFYKENVMKLSRIHHDQPVKPLDRAVFWVEFVMRHKGAKHLRPAF
HDLTWFQYHSLDVIGFLLACVATVTFLVTKCCLFCCWKFGKTAKKKKRE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgaagactgtgaaagtcttctgcatccttttcgtgttgcatctatgtctccttgactcc
gggaggacgggcaaagttcttgtatggcctgtggattttagtcactggattaatttacaa
gttattctagaagagcttcaccttcgtgggcatgagataactgtcctggtaccttcacaa
agtcttctgattgatcataccaagattccctatcatgtggagatcctccggctttcagta
actgaagaaactttcatggaagagctcaataccattctctatgaagctacgtttgaactg
ccaaaactttcatggtgggaaatgcaaacaaaactggcaaatctaggcagaagattttta
ttaacaaacagaagagtgtgtgacagtgctatcacaaacaaggggttactcagcaggcta
caggcagccaagtttgatgtctgtattgctgaccctttaagtttttgtggggaattggtg
gctgaactcctgaatattccatttatatacacttttcgacttttctatgggaatgtcatt
gaaagactgtgtgctgggcttcctatgccttcttcatatgttcctggtgtcacatcaaga
ctgacagacaagatgacttttagacagaggctggagaactggttactctatacagtgagt
gacatgatatattcatattatatatttccagaatgggatgagtattacagcaaggtttta
ggaaaacctaccacactgtgtgagattatggggaaagctgacatgtggttgtttcgaagt
tactgggattttgaatttcctcagccttatttacctaatactgaatttgttggaggactg
cactgcaagcctgcaaagcccctacctaaggaattcgaagagtttgttcaaagctctgga
aaagatggagttgtggtgtttactctggggtcaatgatcaaaaacctctcagaagaaaag
tctaatatgattgcatcagcccttgcccagattccacagaaggttctgtggagatacaca
ggaaagaaaccagaaacattaggagccaatacccgactatataaatggattccacagaat
gatcttcttggccatccaaaaaccagagcttttatcactcactgtggaaccaatgggatc
tatgaagctatttaccatggtgtccctatagttggaattcctatgtttggtgatcagcat
gataatgttgctcgtatgaaagccaaaggggcagctgttgatgtagacttgcaaagaatg
acaagtgcagatctgcttaatgctttgaaagcagttattaacaaccctttctataaagag
aatgtgatgaagttatcaagaattcaccatgatcagcctgtgaaacccctggaccgagca
gtcttctgggttgagtttgtcatgcgccacaaaggagccaagcaccttcgaccagctttc
catgacctcacctggttccagtaccactctttggatgtgattggcttcctgctagcctgt
gtggcaactgttacattcctggtcactaaatgttgcctgttttgctgctggaagtttggt
aaaactgcaaagaagaaaaagagagagtag

KEGG   Bubalus bubalis (water buffalo): 102398239
Entry
102398239         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102398239
   00053 Ascorbate and aldarate metabolism
    102398239
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102398239
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102398239
   00860 Porphyrin and chlorophyll metabolism
    102398239
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102398239
   00982 Drug metabolism - cytochrome P450
    102398239
   00983 Drug metabolism - other enzymes
    102398239
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102398239
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102398239
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102398239
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102398239
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102398239
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 102398239
NCBI-ProteinID: XP_025145758
LinkDB
Position
7
AA seq 529 aa
MKTVKVFCILFMLHLCLFDSGRTGKVLVWPADFSHWINLQVILEELHHRGHEITVLIPSP
SLLIDHTKVPYNVEILQLSVTKETSMEEINTILYEASFDMSKFSWWEMQIKLANIGRKFL
LINKRVCDSAITNKELLSRLQAAKFDVCIADPLRFCGELVAELLNIPFIYTYRVFYGNAI
ERLCAGLPMPSSYIPCITSRLTDNMTFIQRLENWLLYTVNDMIYSYYVFPEWDEYYSKVL
GKHTTLCEIMGKADMWLFRSYWDFEFPQPYLPNTEFVGGLHCKPAKPLPKEFEEFVQSSG
KDGVVVFTLGSMIKNLSEEKSNMIASALAQIPQKVLWRYTGKKPETLGANTRLYKWIPQN
DLLGHPKTRAFITHCGTNGIYEAIYHGVPIVGIPVFGDQYDNVIRMKAKGAAVEVDLQRM
TSADLLNALKAVINNPFYKENAMKLSRIHHDQPVKPLDRAVFWVEFVMRHKGAKHLRPAF
HDLTWFQYHSLDVIGFLLACVATVAFLVTKCCLFCYWKFGKTAKKKKRE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgaagactgtgaaagtcttctgcatccttttcatgctgcatctatgtctctttgactct
ggaaggacgggcaaagttcttgtatggcctgcggattttagtcattggattaatttacaa
gttattctagaagaacttcaccatcgtgggcatgagataactgtcttgataccttcacca
agtcttctgattgatcataccaaggttccctataatgtggagatcctccaactttcggta
actaaagaaacttccatggaagagatcaataccattctctatgaagcttcttttgacatg
tcaaaattctcatggtgggaaatgcaaataaaactggcaaacataggcagaaaattttta
ttaataaacaaaagagtgtgtgacagtgctatcacaaacaaggagttactcagcaggcta
caggcagccaagttcgatgtatgtattgctgaccctttaagattttgtggggaattggtg
gctgaactcctgaatattccatttatatacacttatcgggttttctatgggaatgccatt
gaaagactgtgtgctgggcttcctatgccttcttcatatattccttgtatcacatcaaga
ctgacagacaacatgacttttatacagaggctggagaactggttactgtatacagtgaat
gacatgatatattcatattatgtatttccagaatgggatgaatattacagcaaggtctta
ggaaaacataccacactatgtgagattatggggaaagcggacatgtggttgtttcgaagt
tactgggattttgaatttcctcagccttacttacctaatactgaatttgttggaggactg
cactgcaagcctgcaaagcccctacctaaggagtttgaagagtttgttcaaagctctgga
aaagatggagtcgtggtgtttactctggggtcaatgatcaaaaacctctcagaagaaaag
tctaatatgattgcatcagcccttgcccagattccacagaaggttctgtggcgatacaca
ggaaagaaaccagaaacactaggagccaatacccgactatataaatggattccacaaaat
gatcttcttggacatcccaaaaccagagcttttatcactcactgtggaaccaatgggatc
tatgaagctatttaccatggggtccctatagttggaattcctgtgtttggtgatcagtat
gataatgttattcgtatgaaagccaaaggggcagctgttgaagtagacttgcaaagaatg
acaagtgcagatctgcttaatgctttgaaagcagttattaacaaccctttctataaagag
aatgctatgaagttatcaagaatccaccatgatcaacctgtaaaacccctggaccgagca
gtcttctgggttgagtttgtcatgcgccacaaaggagccaagcaccttcgaccagccttc
catgacctcacctggttccagtaccactctttggatgtgattggcttcctgctagcctgt
gtggcaactgttgcattcctggtcactaagtgttgcctgttttgttactggaagtttggt
aagactgcaaagaagaaaaagagagagtag

KEGG   Bubalus bubalis (water buffalo): 102398438
Entry
102398438         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A3 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102398438
   00053 Ascorbate and aldarate metabolism
    102398438
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102398438
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102398438
   00860 Porphyrin and chlorophyll metabolism
    102398438
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102398438
   00982 Drug metabolism - cytochrome P450
    102398438
   00983 Drug metabolism - other enzymes
    102398438
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102398438
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102398438
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102398438
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102398438
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102398438
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 102398438
NCBI-ProteinID: XP_006071194
LinkDB
Position
7
AA seq 556 aa
MSKLPLQFCAQKAFSHCRAVCEGAAIMMSKKWVSAILLLQLCYTGCGFCEKVLVWPCDMS
HWLNLKVILEKLMERGHEVTVLVSSQNFLIENNKPSTLNFEMFSVPQDKETAEDSLNEFL
NLSVNVMPTLSPWQSAKKLQDFFLQISADLKLVCESVVYNQTIMKKLQDTNYNVMVIDPV
MPCGELIAEILGIPFVYTLRLSLGSTMERYCGQIPSPPSYVPVVMAALPDKMTLLQRVKN
LMFTIFFDFGLQQYDTQLWDQFYSEVLGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPN
FEFVGGLHCKPAKPLPKEMEEFVQSSGEDGIVVFSLGSMIKNLTEEKANRIASALAQIPQ
KVLWRYKGKKPATLGANTRLYDWIPQNDLLGHPKAKAFITHGGTNGIYEAIYHGVPMVGV
PMFADQPDNIAHMKAKGAAVEVNINTMTSADLLNALRTVINEPSYKENAMRLKRIHHDQP
VKPLDRAVFWIEFVMRHKGAKHLRPAAHNLTWYQYHSLDVIGFLLACVATAVFLVTKCCL
FSCRKFGKTGKKKKRE
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgtctaaattgccacttcaattttgtgcccaaaaagcattcagccattgcagagcagtg
tgtgagggagctgctatcatgatgtccaagaaatgggtttcagcaattctactgctgcag
ctctgctatactggctgtggattctgtgagaaggtcctggtgtggccctgtgacatgagc
cactggctcaatctaaaggttattctggagaaactcatggaaagaggccatgaagtgact
gtgttggtgtcttcacaaaattttctcattgagaacaacaagccttccacactgaacttc
gagatgttctcagtgccgcaggacaaagagactgctgaagatagtctaaacgaatttttg
aatctatctgttaacgtcatgccaacattgtcaccctggcaatcagcaaagaaacttcaa
gattttttccttcaaataagcgcagatttaaaacttgtctgtgagagtgttgtctacaac
cagacaatcatgaagaaactccaggacaccaactataatgttatggttatagaccctgtg
atgccctgtggagagctgattgctgagattctgggaatcccttttgtgtacacactaaga
ctctctttgggtagcacaatggagagatactgtgggcaaattccatctccaccttcctac
gtgcctgttgtcatggcagcattaccagacaaaatgacccttctgcaaagggtaaaaaat
ttaatgtttaccattttctttgacttcgggctccaacaatatgacactcagctttgggac
cagttttacagtgaagtattaggaagacccactacgctatgtgagactatggggaaagca
gagatttggctcatcaggacatactgggattttgaatttcctcgtccatacttaccaaat
tttgagtttgtaggaggattgcattgtaaaccggccaaaccactacctaaggaaatggaa
gaatttgtccaaagttcgggtgaagatggtattgtggtattttctctggggtcaatgatc
aaaaatctcacagaagaaaaagccaatcgcattgcctcagctcttgcccagattccacaa
aaggttttatggagatacaaaggaaagaaacctgccacgttaggagccaatactcggctc
tatgattggataccacagaatgatcttcttggtcatcccaaagcaaaagcatttatcact
catggtgggaccaatgggatctatgaagctatctatcatggggtgcctatggtgggagtc
ccaatgtttgctgatcagcctgacaacattgctcacatgaaggccaaaggagcagctgtg
gaagtgaatataaacacaatgacaagtgcagatttgctcaatgccttgagaacagtcatt
aatgagccttcttataaagagaatgctatgaggctaaaaaggattcaccatgatcagcct
gtaaagcccctggaccgagcagtcttctggattgaatttgtcatgcgccacaaaggagcc
aagcacctgaggccagccgcccacaacctcacctggtaccagtaccactctctggatgtg
attgggttcctgctggcctgtgtggcaacagctgtattcttggtcacaaagtgctgtctg
ttttcttgtcgaaaatttggtaaaacaggaaagaagaaaaaaagagaatag

KEGG   Bubalus bubalis (water buffalo): 102398487
Entry
102398487         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102398487
   00053 Ascorbate and aldarate metabolism
    102398487
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102398487
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102398487
   00860 Porphyrin and chlorophyll metabolism
    102398487
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102398487
   00982 Drug metabolism - cytochrome P450
    102398487
   00983 Drug metabolism - other enzymes
    102398487
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102398487
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102398487
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102398487
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102398487
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102398487
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 102398487
NCBI-ProteinID: XP_025145759
LinkDB
Position
7
AA seq 529 aa
MKTVKVFCILFMLHLCLLDSGRMGKVLVWPADFSHWINLQVILEELHLRGHEITVLVPSQ
NLVIDHTKIPYHVEILHISVTKETLIEELNTILYEEIFELPKLSWWEMQIKPADLERKFL
LINRRVCDSAITNKELLSRLQAAKFDVCIADPLSFCGELVAEVLNIPFILTFRFFCGNVI
ERLCAGLPMPSSYVPGITSRLTDKMTFRQRLENWLLYTVSDMIYSYYIFPEWDEYYSKVL
GKPTTLCEIMGKADIWLFRSYWDFEFPQPYLPNTEFVGGLHCKPAKPLPKEFEEFVQSSG
EDGVVVFTLGSMIKNLSEEKSNMIASALAQIPQKVLWRYTGKKPETLGANTRLYKWIPQN
DLLGHPQTRAFITHCGTNGIYEAIYHGVPMVGIPMFGDQHDNLVHMKAKGTAVEVDMQRM
TSADLLNALKAVINNTSYKENAMKLSRIHHDQPVKPLDQAVFWVEFVMRHKGAKHLRPAF
HDLNWFQYHSLDVIGFLLACVATVAFLVTKCCLFCCWKFGKTAKKKKRE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgaagactgtgaaagtcttctgcatccttttcatgctgcatctatgtctccttgactcc
gggaggatgggcaaagttcttgtatggcctgcggattttagtcactggattaatttacaa
gttattctagaagagcttcaccttcgtgggcatgagataactgtcctggtaccttcacaa
aatcttgtgattgatcataccaagattccctatcatgtggagatcctccatatttcagta
actaaagaaactttgatcgaagagctcaataccattctctatgaagaaatttttgaactg
ccaaagctctcatggtgggaaatgcaaataaaaccggcagacttagagagaaaattttta
ttaataaacagaagagtgtgtgacagtgctatcacaaacaaggagttactcagcaggcta
caggcagccaagtttgatgtctgtattgctgaccctttaagtttttgtggggaattggtg
gctgaagtcctgaatattccatttatactcacttttaggtttttctgtgggaatgtcatt
gaaagactgtgtgctgggcttcctatgccttcttcatatgttcctggtatcacatcaaga
ctgacagacaagatgacttttagacagaggctggagaactggttactgtatacagtgagt
gacatgatatattcatattatatatttccagaatgggatgaatattacagcaaggtttta
ggaaaacctaccacactatgtgagattatggggaaagctgacatatggttgtttcgaagt
tactgggattttgaatttcctcaaccttacttacctaatactgaatttgtcggaggactg
cactgcaagcctgcaaagcccctgcctaaggagttcgaagagtttgttcaaagctctgga
gaagatggagttgtggtttttactctggggtcaatgatcaaaaacctctcagaagaaaag
tctaatatgattgcatcagcccttgcccagattcctcagaaggttctgtggagatacaca
ggaaagaaaccagaaacactaggagccaatacccggctatataaatggattccacagaat
gatcttcttggtcatccccaaaccagagcttttataactcactgtggaaccaatgggatc
tatgaagctatttaccacggggtccctatggttggaattcctatgtttggtgatcagcat
gataatcttgttcatatgaaagccaaagggacagctgttgaagtagacatgcaaagaatg
acaagtgcagatctgcttaatgctttgaaagcagttattaacaatacttcctataaagag
aatgcgatgaagttatcaagaattcaccatgatcagcctgtgaaacccctggaccaagca
gtcttctgggttgagtttgtcatgcgccacaaaggagccaagcaccttcgaccagctttc
catgacctcaactggttccagtaccactctttggatgtgattggcttcctgctagcttgt
gtggcaactgttgcattcctggtcactaaatgttgcctgttttgctgctggaagtttggt
aagactgcaaagaagaaaaagagagagtag

KEGG   Bubalus bubalis (water buffalo): 102398807
Entry
102398807         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102398807
   00053 Ascorbate and aldarate metabolism
    102398807
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102398807
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102398807
   00860 Porphyrin and chlorophyll metabolism
    102398807
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102398807
   00982 Drug metabolism - cytochrome P450
    102398807
   00983 Drug metabolism - other enzymes
    102398807
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102398807
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102398807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102398807
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102398807
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102398807
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Adeno_E3_CR2
Other DBs
NCBI-GeneID: 102398807
NCBI-ProteinID: XP_006080236
LinkDB
Position
7
AA seq 535 aa
MSKMSMKSLSFLLLLQLTCYFSSGFCGKVLVWPVEFSHWMNMKAVLDELVMRGHEVTVLI
SSASTITDANKPSAFKFEIFPVSLTKDDFENAVKNLIEKWTYMAKNSFWTNVSSLRELKS
LLWEFSGMLMKMCKEVVSKKKLITKLQESRFDVLLADAAGPCGELLTELLRIPLVYSLRF
SPGYLFEKYSGKLSFPPSYVPVIFSALSDHMTFMERVKNMLYVLYFDFWFQTFDEKTWNE
FYSGVLGRPTTFLETIGKADMWLIRTYWDFEFPRPVLPNFEFVGGLHCKPAKPLPKEMEE
FVQSSGENGIVVFTLGSMISNITEEKANVIASALAQIPQKVLWRYDGKKPDTLGPNTRLY
KWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGLPLFADQPDNIVRVKAKGAAVR
VDLETMSSRDLLNALKEVINNPSYKEKAMWLSTIQRNQPIKPLDRAVFWIEFVMRHKGAK
HLRPAAHNLTWFQYHSLDVIGFLLACVATVVFVTTKCFLFCYRKFAKTGKKQKRE
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgagcaagatgtctatgaaatcgctctcatttctgctgctactacagctgacttgctat
tttagctctgggttttgtggaaaggtgctggtgtggccagtggaatttagtcattggatg
aatatgaaggcagttctggatgaactagtcatgaggggtcatgaggtgactgttctaata
tcttcagcttccactattactgatgccaacaaaccatctgcttttaagtttgagattttc
cctgtatctttaactaaagatgattttgaaaatgctgtcaagaatttgattgagaaatgg
acatatatggcaaaaaattcattttggacaaatgtttcatcattgagagaattgaaaagt
ttactttgggaattttctggaatgcttatgaaaatgtgtaaagaagttgtttcaaaaaag
aaacttataacaaaactacaggaatcaaggtttgatgtccttcttgcagatgccgctgga
ccctgtggtgagctgcttactgagttacttagaattcctttagtgtacagtctccgtttt
tcgcctggctatttgtttgaaaaatatagtggaaaactttcattcccaccatcctatgtg
cctgttatattttcagcattaagtgatcacatgacattcatggaaagggtcaaaaatatg
ctatatgtactttattttgacttctggttccaaacatttgatgagaagacatggaacgag
ttttacagtggagtactgggtagacccactacatttttagagacaattggaaaagctgat
atgtggctgattcgaacctattgggattttgaatttcctcgcccagtgctgccaaatttt
gaatttgttggaggcctccactgcaaacctgccaaacccctacctaaggaaatggaagag
tttgttcagagctctggagaaaatggtattgtggtgtttactttggggtcaatgatcagt
aacataacagaagaaaaagccaatgtaattgcatcagctcttgcccagattccacaaaaa
gttctatggagatatgatggcaagaaaccagataccctagggcccaatactcgtctgtat
aagtggataccccagaatgaccttcttggtcacccaaaaaccaaagcctttataactcat
ggtggaaccaatggcatttatgaggctatctaccatgggatccctatggtgggccttcct
ttgtttgctgatcaacctgataacattgtgcgagtgaaggccaagggagcagctgtcaga
gtggacttggaaacaatgtcatcaagagatctgctcaacgcattgaaggaagtcattaac
aatccttcctacaaagagaaggctatgtggttatccaccattcaacgcaatcagcctata
aagcccctggaccgagcagtcttctggattgagtttgtcatgcgccacaaaggagccaag
cacctgcggccagcagcccacaacctcacctggttccagtaccactctctggatgtgatt
gggttcctgctggcctgtgtggcaactgttgtatttgtcaccacaaaatgctttctcttt
tgttaccgcaagtttgctaaaacaggaaagaagcaaaaaagggagtag

KEGG   Bubalus bubalis (water buffalo): 102399410
Entry
102399410         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102399410
   00053 Ascorbate and aldarate metabolism
    102399410
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102399410
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102399410
   00860 Porphyrin and chlorophyll metabolism
    102399410
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102399410
   00982 Drug metabolism - cytochrome P450
    102399410
   00983 Drug metabolism - other enzymes
    102399410
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102399410
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102399410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102399410
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102399410
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102399410
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 102399410
NCBI-ProteinID: XP_006071198
LinkDB
Position
7
AA seq 529 aa
MKTVKGFYVLFMLHLWFFDSGRTGKILVWPMDFSHWINLKIILDELYLGGHEITVLIPST
SSLLDHTQIPFNVEILEIPISKESFMEEFTANLYTLSFELPKVSWWERQVRLTKMLKTFL
ATIRSICDSVVMNKELLTRLQAAKFDICIADPLSFCGELVAELLNIPFIYSFRFSYGNVI
ERLCAGLPMPSSYVPGTVSGLTDSMTFIQRLENWLSYTVNDVMYSYFVFPEWDEYYSKVL
GKSTKLCEIMGKAEMWLIRTNWDFEFPHPFLPNFEFVGGLHCKPAKPLPKEFEEFVQSSG
KNGVVVFTLGSMVKNLTEENSKMIASALAQIPQKVLWKYGGKKPENLGANTRIYEWIPQN
DLLGHPKTRAFITHCGTNGVYEAIYHGVPMVGIPLFGDQYGNVARVKAKGAAIELDLQRM
TSSDLLNALKAVINNPSYKENAMELSRIHHDTPVKPLKRAVFWIEFIMHHKGAKHLRPAF
HDLTWYQHHSLDVIGFLLACVATIIFLVTKCCLFCCGKFGKISKKKKRE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgaagactgtgaaaggcttctatgtccttttcatgctgcatctatggttctttgactct
ggaaggaccggaaagatacttgtatggcccatggatttcagtcactggattaatttaaag
attattctggatgaactctaccttggtgggcatgagataactgtcctcataccttcaaca
agttctctgcttgatcatacccagattccctttaacgtggagatccttgaaattccaata
agtaaagaaagtttcatggaagaattcactgctaatctctacacactttcttttgaactg
ccgaaagtttcatggtgggagaggcaagtacgactgacgaaaatgttgaaaacgttttta
gcaacaatcagaagcatttgtgacagtgttgtcatgaacaaggagttgctcaccaggctt
caggcagctaagtttgatatctgtattgctgaccctttaagcttctgtggggagttagtg
gctgagcttctcaacattccatttatatactcctttcggttttcctatgggaatgtcatt
gagagattgtgtgctgggcttcctatgccttcttcatatgttcctggcaccgtatcagga
ctgacagacagcatgacttttatacagaggctggagaactggttatcgtatacagtgaat
gacgtgatgtattcatattttgtatttccagaatgggatgaatattacagcaaggtttta
ggaaaatctaccaaattatgtgagattatgggaaaagctgaaatgtggttgattcgaact
aactgggattttgaatttcctcaccctttcttacctaactttgaatttgttggaggactg
cactgcaagcctgcaaaacccttgcctaaggagtttgaagagtttgttcaaagttctgga
aaaaatggagtcgtggtgtttactctgggatcaatggtcaaaaacctcacagaagaaaac
tctaaaatgattgcatcagcccttgcccaaattccacaaaaggttctgtggaaatatgga
ggaaagaaaccagaaaatttaggagccaatacccggatatatgaatggattccacagaat
gatcttcttggtcatcccaaaaccagagcttttatcactcactgtggaaccaatggtgtc
tatgaagctatctaccatggggtccctatggtgggaatccccctgtttggtgatcagtat
ggcaatgttgctcgtgttaaagccaaaggagcggctattgaattagacttgcagagaatg
acgagttccgatctgcttaacgctttgaaggcagttattaacaaccctagctataaagag
aatgctatggagttatcaagaattcaccatgatacaccggtgaagcccctcaaacgagca
gtcttctggattgagtttatcatgcatcacaaaggagccaaacatcttcgaccagccttt
cacgacctcacctggtaccagcaccactctttggatgtgattggcttcctgctagcttgt
gtggcaactattatattcctggtcactaaatgttgcctgttttgttgtgggaagtttggt
aaaatttccaagaagaaaaagagagagtag

KEGG   Bubalus bubalis (water buffalo): 102404752
Entry
102404752         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B31 isoform X1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102404752
   00053 Ascorbate and aldarate metabolism
    102404752
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102404752
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102404752
   00860 Porphyrin and chlorophyll metabolism
    102404752
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102404752
   00982 Drug metabolism - cytochrome P450
    102404752
   00983 Drug metabolism - other enzymes
    102404752
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102404752
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102404752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102404752
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102404752
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102404752
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 102404752
NCBI-ProteinID: XP_025145765
LinkDB
Position
7
AA seq 544 aa
MAKGYSYFKEVLPMNMMAMKWLLLLLLLQLTCYFSSGSCGKVLVWPVEYSHWMNMKIILD
ELVMRGHEVTVLTSSASIFIDPSKPSAIKFENFSVSLTKDDFEDALKNFVRNWTDLTNSF
WTFPLLLQSLFEEYSDLTLKICKELVSNKKLMTKLHESRFDVVLADTVGPCGELLAEILK
VPLVYSVRFTPGYSIERKSGKLPYSPSYVPVILSELSDHMTFMERVKNMIYVLYFEFYFQ
MLNEKKWDQFYSEVLGRPTTLLETMEKAEFWLFRSYWDFEYPCPLLPNVEFIGGLHCKPA
KPLPKEMEEFVQSSGENGIVVFTLGSMVTNMTEERANMIASALAQIPQKVLWRHDGKKPD
TLGPNTRLYKWVPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGLPLFAEQPDNINR
VKAKGAAVRLDLETMSKTDFLNALKQVINNPSYKRNAMWLSTIQRDQPIKPLDRAVFWIE
FVMRHKGAKYLRPAAHKLTWFQYHSLDVIGFLLACVATAVFVITKCFLFCCRKFAETGKK
RKRE
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggcaaaaggatacagttattttaaagaagtactgcctatgaacatgatggctatgaaa
tggctcttgcttctgctgctgctacagctgacttgctactttagctctgggagttgtgga
aaggtgctggtgtggccagtggaatatagtcactggatgaatatgaagataattctggat
gaacttgtcatgaggggtcatgaggtgactgttttgacatcttcagcttccatttttatt
gatcccagcaaaccatctgccatcaaatttgagaatttctcagtatctttaactaaagat
gattttgaggatgctttgaagaattttgtcaggaactggacagacctgacaaattcattt
tggacatttcctttgttactgcaaagcttatttgaggaatattctgatcttactctaaag
atctgtaaagaacttgtttcaaacaagaaacttatgacaaaactacatgaatcaaggttt
gatgttgtccttgcagataccgttggaccctgtggagagctgctggctgagatacttaaa
gtacctttagtgtacagtgtccgcttcactcccggttattcaattgaaaggaagagtggg
aaacttccatactcaccatcctacgtacctgttatattgtctgaattaagtgatcacatg
acattcatggagagggtcaaaaatatgatatatgtactttattttgagttttacttccag
atgttaaatgagaagaagtgggaccagttttacagtgaagtactaggaagaccaactaca
ttattagagacaatggaaaaagctgaattttggctctttcgatcctactgggattttgaa
tatccttgcccactactaccaaatgttgaatttattggaggcctccactgcaaacctgcc
aaacctctgcctaaggaaatggaagagtttgtgcagagctctggagaaaatggtattgtg
gtgtttactttggggtcgatggtcactaacatgacagaagaaagagccaatatgattgca
tcagctcttgcccagattccacaaaaggttttatggagacatgatggcaagaaaccagac
accttaggacccaatactcggctgtataagtgggtcccccagaatgaccttcttggtcat
ccaaaaaccaaggcctttataactcatggtggaaccaatggcatttatgaggctatttac
cacggggtccctatggtgggccttcctttgtttgctgagcaacctgataacatcaaccga
gtgaaggccaaaggagcagctgtcagattggacttggaaacaatgtcaaaaacagatttc
ctcaatgcactgaagcaagtcattaacaatccttcgtataaacggaatgctatgtggtta
tcaaccattcaacgtgatcagcctataaagccccttgaccgagcagtcttctggatcgaa
tttgtcatgcgccacaaaggagccaagtacctgaggccagcagcccacaagctcacctgg
ttccagtaccactctctggacgtgatcgggttcctgctggcctgtgtggcaactgctgta
tttgtcatcacaaaatgttttctgttctgttgccgaaagtttgctgaaacaggaaagaag
aggaaaagggaatag

KEGG   Bubalus bubalis (water buffalo): 102407350
Entry
102407350         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102407350
   00053 Ascorbate and aldarate metabolism
    102407350
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102407350
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102407350
   00860 Porphyrin and chlorophyll metabolism
    102407350
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102407350
   00982 Drug metabolism - cytochrome P450
    102407350
   00983 Drug metabolism - other enzymes
    102407350
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102407350
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102407350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102407350
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102407350
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102407350
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 102407350
NCBI-ProteinID: XP_006042349
LinkDB
Position
7
AA seq 532 aa
MNKMSMKWLLLLQLLQLTFYFSSGSCGKVLVWPVEFSHWMNMKTILDELVTRGHEVTVLQ
SSASTLIDPNKPLAMKFETFPVSLAKDDFQTLAKILIETWMLVVKDFFWIHLSTMQSLLD
EFSDIGIKICKEVVSNKKLMTKLQESRFDVVLADAVGPCGELLAEILKVPLVYSLYFSPG
YLVEKRSARLSFPPSYVPVMLSELSDHMTFMERVKNMIYVLYFDYWFQLYNEKKWNQFYS
EVLGRPTTIAESMGKAEMWLIRNYWDFSFPRPGLPNVEFVGGLHCKPAKPLPKEMEEFVQ
SSGEHGIVVFSLGSMVSNMSEERANVIASALAQIPQKVLWRYDGKKPDTLGPNTRLYKWI
PQNDLLGHPKTKAFITHGGSNGIYEAIYHGIPMVGLPLFADQPHNIVHMTAKGAAIRLDL
ETMSTADLLNALKEVINNPFYKENIMRLSAIQHDQPMKPLDRAVFWIEFVMRHKGAKHLR
PASHNLTWFQYHSLDVIGFLLACVATVVFVITKCCLFCCRKFANIGKKGKRD
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgaacaagatgtctatgaaatggctcttgcttctgcagctgttacagctcactttctat
tttagctctgggagttgtggaaaagtgctggtgtggccagtggaatttagtcactggatg
aatatgaagacaattctggatgagcttgtgacgaggggtcatgaggtgactgtactgcaa
tcttcagcttccactcttattgatcccaacaaaccattggctatgaaatttgagactttc
cctgtatctttagctaaagatgattttcagactcttgccaagattttgattgagacatgg
atgcttgtggtgaaagatttcttttggatccatctttcaacaatgcaaagtctacttgat
gagttttctgatattggtataaagatatgtaaggaagttgtttcaaataagaaacttatg
acaaaactacaggaatcgaggtttgatgtcgttcttgcagatgctgttggaccctgtgga
gagctgctggctgagatacttaaagtacctttagtgtacagtctctacttctcaccgggc
tatttggttgaaaaaaggagtgcaagactttcatttccaccatcctatgtacctgttatg
ttgtctgaattaagtgatcacatgacattcatggagagggtcaaaaatatgatatatgta
ctttattttgactactggtttcagctgtacaatgagaagaagtggaatcagttttacagt
gaagtactaggaaggcccactacaatagcagagtcgatggggaaagccgaaatgtggctt
attcgaaactattgggatttttcatttcctcgcccaggactaccaaatgttgaatttgta
ggaggcctccactgcaaacctgccaagcccctgcctaaggaaatggaagaatttgtgcag
agctctggagaacatggtattgtggtgttttcattggggtcaatggtcagtaacatgtca
gaagaaagagccaatgtgattgcatcagcccttgcccagattccacaaaaggttctatgg
agatatgatggcaagaaaccagacaccttaggacccaatactcggctgtataagtggatc
ccccagaatgaccttcttggtcatccaaaaaccaaagcctttataactcatggtggaagc
aatggcatttatgaggccatctaccatggaatccctatggtgggccttcctttgtttgct
gatcaacctcataacattgttcatatgacggccaagggagcagctatcagattggacttg
gaaacaatgtcaacagcagatttgctcaatgcattgaaggaagtcattaataatcctttc
tacaaagagaatatcatgaggttatcagccattcaacatgatcagcctatgaaacccttg
gacagagcagtcttctggattgaatttgtcatgcggcacaaaggagccaagcacctgcgg
ccagcctcccacaacctcacctggttccagtaccactctctggatgtgattgggtttctg
ctggcctgtgtggcaactgttgtatttgtcattacaaagtgttgtctgttttgttgccgg
aagtttgctaacataggaaagaaggggaaaagagactag

KEGG   Bubalus bubalis (water buffalo): 102408678
Entry
102408678         CDS       T05912                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: UDP-glucuronosyltransferase 2B17-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102408678
   00053 Ascorbate and aldarate metabolism
    102408678
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102408678
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102408678
   00860 Porphyrin and chlorophyll metabolism
    102408678
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102408678
   00982 Drug metabolism - cytochrome P450
    102408678
   00983 Drug metabolism - other enzymes
    102408678
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102408678
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102408678
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102408678
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102408678
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102408678
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 102408678
NCBI-ProteinID: XP_025145763
LinkDB
Position
7
AA seq 529 aa
MSMKRLSLLLLLQLTCYFSGGSCGKVLVWPVEFSHWLNIKTILDELVTRGHEVTVLISSA
STIPNSSKPSTMKFETFPVSLTTSDYENFIEHLLEELTYVAKDSFWSYLSTLKSLFWEFF
ETALSMCKDAVSNKKLMTKLQESRFDILIADAVGPCGELLAELLKIPFVYSHYTSPGHII
EKKSGRLPFPPSYVPVMFAELSDRMTFMERIKNMLYTLYFELFFPTYKEKKWNQFYSEVL
GRPTTLSETMGKAEMWLIRTYWDFSFPRPXLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
ENGIVVFSLGSMVSNMSEDRAKVIASAFAQIPQKVLWRYDGKKPDTLGPNTRLYKWLPQN
DLLGHPKTKAFITHGGSNGVYEAIYHGIPMVGTPLFADQADNIARMKSKGTAVRLDLETM
STRDLLNALKEVINNPSYKENVMRLSAIQHDQPMKPLDRAVFWIEFVMRHKGAKHLRPAI
HDLTWFQYHSLDVIGFLLACVATTIFVIIKCCLFCFLKFAKLGKKEKRD
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtctatgaaaaggctctcgcttctgctgctgctacagctgacttgctactttagcggt
gggagttgtggaaaggtgctggtatggccagtggaatttagtcactggctgaatataaag
acaattctggacgaacttgtcacgaggggtcatgaggtgactgttctgatatcttcagct
tccactattcctaattccagcaaaccatctaccatgaaatttgagacttttcctgtatct
ttaacaacaagtgattatgagaattttatagaacatcttcttgaggaactgacgtatgtg
gcgaaagattccttttggtcctatctttcaacactgaaaagtttattttgggaatttttt
gaaactgctttaagtatgtgtaaagacgctgtttccaacaagaaattaatgacaaaactg
caggaatcaaggtttgatatccttattgcagatgctgttggaccctgtggtgaattgctg
gctgaattactcaaaataccattcgtgtacagtcattacacctcacctggccacataatt
gagaagaaaagtggaagacttccattcccaccatcttatgtacctgttatgtttgcagaa
ttaagtgatcgcatgacattcatggagaggatcaaaaatatgttatatacactttatttt
gagcttttcttcccaacgtacaaggagaagaagtggaatcagttttacagtgaagtacta
ggaagacctactaccttatcagagacaatggggaaagctgaaatgtggctcattcgaacc
tactgggatttttcatttcctcgtccatgactaccaaatgttgaatttgttggagggctc
cactgcaaacctgccaagcccctgcctaaggaaatggaagagtttgtgcagagctctgga
gaaaatggtattgtggtgttttctttggggtcaatggtcagtaacatgtcagaagacaga
gccaaggtgattgcatcagccttcgctcaaattccacaaaaggtgctatggagatatgat
ggcaaaaaaccagataccttaggacccaacacccggttgtataaatggcttccccagaat
gaccttcttggccatccaaaaaccaaagcctttataactcacggtggaagcaatggcgtt
tatgaggccatctatcacgggatccctatggtgggcactcctttgtttgctgatcaagct
gataacatcgctcgaatgaaatccaagggaacggctgtcagattggacttggaaacaatg
tcaacaagagatttgctcaacgccttgaaggaagtcattaataatccttcctacaaagag
aatgtgatgagattatcagccattcaacatgatcagcctatgaagcccttggacagagca
gtcttctggatcgagtttgtcatgcgccacaaaggagccaagcacttgcggccagctatc
catgacctcacctggttccagtaccactctctggatgtcattgggttcctactggcctgt
gtggcaactaccatatttgtcatcataaaatgttgtctattttgtttcttgaagtttgct
aaattaggaaagaaggagaaaagagactag

KEGG   Bubalus bubalis (water buffalo): 102410098
Entry
102410098         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102410098
   00053 Ascorbate and aldarate metabolism
    102410098
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102410098
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102410098
   00860 Porphyrin and chlorophyll metabolism
    102410098
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102410098
   00982 Drug metabolism - cytochrome P450
    102410098
   00983 Drug metabolism - other enzymes
    102410098
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102410098
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102410098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    102410098
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102410098
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   102410098
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_2
Other DBs
NCBI-GeneID: 102410098
NCBI-ProteinID: XP_006043544
LinkDB
Position
7
AA seq 531 aa
MNMMSMKRLSFLLLLQLTCYFNSGNCGKVLVWPVEYSHWINIKTILDELVSRGHEVTVMT
SSASIFINTRKEFGIKYENFPVSLTKGDFEYIFQDLLEKWTYMEKDSFLSYFSSVQSLFW
KYSDVAMKICKEVVSNKKLITKLQESSFDVLLADAIGPCGELLAEILKVPLVYSLRFSPG
FSIERYSGGLSFPPSYVPVIMSELSDQMTFMERVKNMIYVLYFDFCFQTFNEKKWNQFYS
EVLGRQTTLSETMGKAEMWLIRTYWDFQFPHPLLPNFEFVGGLHCKPAKPLPKEMEEFVQ
SSGENGIVVFTLGSMITNMTEERANTIASALAQIPQKVLWRYSGKKPDTLGPNTRLYDWI
PQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQPDNIAHMKAKGAAVSLDL
ETMATRDLLNALNEVINNPSYKKNVMWLSTIQRDQPMKPLDRAVFWIEFVMRHKGAKHLR
PAAHNLAWYQYHSLDVIGFLLACVATAAFVITKCYLFCYQKFLKTGKKKRE
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgaatatgatgtctatgaaacggctctcgtttctactgctgctacagctgacttgctac
ttcaactctggaaactgcggaaaggtgctggtgtggccagtggaatatagtcattggata
aatataaagacaattcttgatgaactggtctcaaggggtcatgaagtgactgttatgaca
tcttcagcttccatttttattaataccagaaaagaatttggtatcaaatatgagaatttc
cctgtatctttaactaaaggtgattttgagtatatcttccaggatttgcttgagaaatgg
acatatatggaaaaagattcatttttgtcatatttttcatcagtgcaaagtttattttgg
aaatattctgatgtggccatgaagatctgtaaagaagttgtttcaaacaagaaacttata
acaaaactacaggaatcaagttttgatgtccttcttgcagatgccattggaccctgtggt
gaactgctagctgagatacttaaagtacctttagtgtacagcctccgcttctctcctggt
ttttcaattgaaagatatagtgggggcctttcatttccaccatcctatgtacctgttatt
atgtcagaattaagtgatcaaatgacattcatggagagggtaaaaaatatgatatatgta
ctttattttgacttttgtttccagacatttaatgagaagaaatggaatcaattttacagt
gaagtactaggaagacagactacattatcagagacaatgggaaaagctgaaatgtggctc
attcgaacctactgggattttcaatttcctcacccactactaccaaattttgaatttgtt
ggaggccttcactgcaaacctgccaaacccctgcctaaggaaatggaagagtttgtccag
agctctggagaaaatggtattgtggtgtttactttggggtcaatgatcactaacatgaca
gaagaaagagccaatacaattgcatcagcccttgcccagattccacaaaaggtgttatgg
agatacagtggcaaaaaaccggacaccttaggacccaatactcggctgtatgactggatt
ccccagaacgaccttcttggtcatccaaaaaccaaagcctttataactcatggtggaacc
aatggcatttacgaggccatataccatgggatccctatggtgggcattcctttgtttgct
gatcaacctgataacatcgctcatatgaaggccaagggagcagctgtcagtttggacttg
gaaacaatggcaacaagagatttgcttaatgcattgaatgaagtcattaataatccttca
tataaaaagaatgtgatgtggttatcaaccattcaacgtgatcagcctatgaagcccctt
gaccgagcagtcttctggattgagtttgtcatgcgccacaaaggagctaagcaccttcgg
ccagccgcccacaatctcgcctggtaccagtaccactctctggatgtgattgggttcctg
ctagcatgtgtggcgactgctgcatttgtcatcacaaaatgttacctattttgttaccaa
aagtttcttaaaacaggaaagaagaagagggagtag

KEGG   Bubalus bubalis (water buffalo): 112577697
Entry
112577697         CDS       T05912                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B17-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub00053  Ascorbate and aldarate metabolism
bbub00140  Steroid hormone biosynthesis
bbub00830  Retinol metabolism
bbub00860  Porphyrin and chlorophyll metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub00983  Drug metabolism - other enzymes
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04976  Bile secretion
bbub05204  Chemical carcinogenesis
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
bbub_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    112577697
   00053 Ascorbate and aldarate metabolism
    112577697
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    112577697
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    112577697
   00860 Porphyrin and chlorophyll metabolism
    112577697
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112577697
   00982 Drug metabolism - cytochrome P450
    112577697
   00983 Drug metabolism - other enzymes
    112577697
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    112577697
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    112577697
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbub01003]
    112577697
Enzymes [BR:bbub01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     112577697
Glycosyltransferases [BR:bbub01003]
 Others
  Hydrophobic molecule
   112577697
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 112577697
NCBI-ProteinID: XP_025145764
LinkDB
Position
7
AA seq 532 aa
MSKMSMKRLSLLLLLQLTCYFSGGSCGKVLVWPVEFSHWLNIKTILDELVTRGHEVTVLI
SSASTIPNSSKPSTMKFETFPVSLTKSDYENFMERFLEELTYVAKDSFWSYLSTVKSLFW
EFFETALSMCKDAVSNKKLMTKLQESRFDILIADAVGPCGELLAELLKIPFVYSHYTSPG
HIIEKKSGRLPFPPSYVPVMFAELSDRMTFMERIKNMLYTLYFDLFFTMYKDKKWNQFYS
EVLGRPTTLSETMGKAEMWLIRTYWDFSFPRPRLPNVEFVGGLHCKPAKPLPKEMEEFVQ
SSGENGIVVFSLGSMVSNMSEDRAKVIASAFAQIPQKVLWRYDGKKPDTLGPNTRLYKWL
PQNDLLGHPKTKAFITHGGSNGVYEAIYHGIPMVGTPLFADQADNIARMKSKGTAVRLDL
ETMSTRDLLNALKEVINNPSYKENVMRLSAIQHDQPMKPLDRAVFWIEFVMRHKGAKHLR
PAIHDLTWFQYHSLDVIGFLLACVATTIFVIIKCCLFCFLKFAKLGKKEKRD
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgagcaagatgtctatgaaaaggctctcgcttctgctgctgctacagctgacttgctac
tttagcggtgggagttgtggaaaggtgctggtatggccagtggaatttagtcactggctg
aatataaagacaattctggacgaacttgtcacgaggggtcatgaggtgactgttctgata
tcttcagcttccactattcctaattccagcaaaccatctactatgaaatttgagactttt
cctgtatctttaacaaaaagtgattatgagaattttatggaacgctttcttgaggaactg
acgtatgtggcgaaagattccttttggtcctatctttcaacagtgaaaagtttattttgg
gaattttttgaaactgctttaagtatgtgtaaagatgctgtttccaacaagaaattaatg
acaaaactgcaggaatcaaggtttgatatccttattgcagatgctgttggaccctgtggt
gaattgctagctgaattacttaaaataccattcgtgtacagtcattacacctcacctggc
cacataattgagaagaaaagtggaagacttccattcccaccgtcttatgtacctgttatg
tttgcagaattaagtgatcgcatgacattcatggagaggatcaaaaatatgttatataca
ctttattttgaccttttctttacgatgtacaaggataagaagtggaatcagttttacagt
gaagtactaggaagacctactaccttatcagagacaatggggaaagctgaaatgtggctc
attcgaacctactgggatttttcatttcctcgtccacgactaccaaatgttgaatttgtt
ggagggctccactgcaaacctgccaagcccctgcctaaggaaatggaagagtttgtgcag
agctctggagaaaatggtattgtggtgttttctttggggtcaatggtcagtaacatgtca
gaagacagagccaaggtgattgcatcagccttcgctcaaattccacaaaaggtgctatgg
agatatgatggcaaaaaaccagataccttaggacccaacacccggttgtataaatggctt
ccccagaatgaccttcttggccatccaaaaaccaaagcctttataactcacggtggaagc
aatggcgtttatgaggccatctatcacgggatccctatggtgggcactcctttgtttgct
gatcaagctgataacatcgctcgaatgaaatccaagggaacagctgtcaggttggacttg
gaaacaatgtcaacaagagatttgctcaacgcattgaaggaagtcattaataatccttcc
tacaaagagaatgtgatgagattatcagccattcaacatgatcagcctatgaagcccttg
gacagagcagtcttctggatcgagtttgtcatgcgccacaaaggagccaagcacttgcgg
ccagctatccatgacctcacctggttccagtaccactctctggatgtcattgggttccta
ctggcctgtgtggcaactaccatatttgtcatcataaaatgttgtctattttgtttcttg
aagtttgctaaattaggaaagaaggagaaaagagactag

DBGET integrated database retrieval system