KEGG   Bubalus bubalis (water buffalo): 102392583Help
Entry
102392583         CDS       T05912                                 

Gene name
CD36
Definition
(RefSeq) platelet glycoprotein 4
  KO
K06259  CD36 antigen
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04145  Phagosome
bbub04152  AMPK signaling pathway
bbub04512  ECM-receptor interaction
bbub04640  Hematopoietic cell lineage
bbub04920  Adipocytokine signaling pathway
bbub04931  Insulin resistance
bbub04975  Fat digestion and absorption
bbub04979  Cholesterol metabolism
bbub05144  Malaria
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102392583 (CD36)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102392583 (CD36)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102392583 (CD36)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102392583 (CD36)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102392583 (CD36)
   03320 PPAR signaling pathway
    102392583 (CD36)
  09154 Digestive system
   04975 Fat digestion and absorption
    102392583 (CD36)
   04979 Cholesterol metabolism
    102392583 (CD36)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102392583 (CD36)
  09174 Infectious disease: parasitic
   05144 Malaria
    102392583 (CD36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102392583 (CD36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102392583 (CD36)
   04090 CD molecules [BR:bbub04090]
    102392583 (CD36)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    102392583 (CD36)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102392583 (CD36)
CD molecules [BR:bbub04090]
 Proteins
  102392583 (CD36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD36
Motif
Other DBs
NCBI-GeneID: 102392583
NCBI-ProteinID: NP_001277767
UniProt: M9WLX8
LinkDB All DBs
Position
8
AA seq 472 aa AA seqDB search
MGCNRSCGLIAGAAIGAVLAVFGGILMPVGDMLIEKTIKKEVVLEEGTIAFKNWVKTGTD
VYRQFWIFDVQNPDEVTVNSSKIKVKQRGPYTYRVRYLAKENVTQDPETHTVSFLQPNGA
IFEPSLSVGTEDDTFTILNLAVAAAPQLYPNTFMQGILNSLIKKSKSSMFQNRTLKELLW
GYTDPFLNLVPYPVTTTIGVFYPYNNTADGIYKVFNGKDDISKVAIIDTYKGRKNLSYWS
SYCDLINGTDAASFPPFVERTRVLQFFSSDICRSIYAVFGAEMNLKGIPVYRFILPSYAF
ASPLQNPDNHCFCTEKIISKNCTLYGVLDISKCKEGKPVYISLPHFLHGSPDLAEPIEGL
SPNEEEHSTYLDVEPITGFTLRFAKRLQINMLVKPAKKIEALKNLKQNYIVPILWLNETG
TIGDEKAEMFRNQVTGKINLLGLVEIVLLSVGVVMFIAFMISYCACRSKGVN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcaatcgaagctgtgggctcattgctggtgctgccattggtgcagtcctggct
gtgtttggagggattctaatgccagttggagacatgcttattgagaagacgattaaaaag
gaagttgtccttgaagaaggcacaattgcttttaaaaattgggttaaaacaggcacagat
gtttacagacagttttggatatttgatgtgcagaatccagatgaagtgacagttaatagc
agcaaaattaaagttaagcaaagaggtccttacacatatagagttcgttatctagccaag
gaaaatgtaacccaggaccctgagacccacacggtctctttcctgcagcccaatggcgcc
atctttgaaccctcactatcagttggaactgaggatgacacgttcaccattctcaacctg
gctgtagcagctgcaccacagctgtatccaaatacatttatgcaaggaatactcaattca
cttatcaaaaagtccaaatcttctatgtttcaaaacagaactttgaaagaactattgtgg
ggctatacggatccattcttgaatttggttccatatcctgttactactacaattggtgtg
ttttatccttacaataatactgcagatggaatttacaaagttttcaatggaaaggacgac
ataagcaaagttgctataattgacacatacaaaggcagaaagaatctctcctattggtca
agttattgtgacctgattaatggtacagatgcagcctcatttccaccttttgttgagagg
acaagggtattgcaatttttctcctctgatatttgcaggtctatctatgctgtgtttgga
gctgaaatgaatctgaaaggaatccctgtgtatagatttattcttccatcctatgctttt
gcatctccacttcaaaatccagacaaccactgtttctgcacagaaaaaatcatctcaaaa
aattgtaccttatatggtgtgctagacattagcaaatgcaaagaaggaaaacctgtgtac
atttcacttcctcattttctacatggaagtcctgatcttgcagaacctattgaaggctta
agtccaaatgaagaagaacacagcacgtacttagatgttgaacctataactggatttact
ttacggtttgcaaaacggctgcagatcaacatgctggtcaagccagcaaaaaaaattgaa
gcactaaagaatctgaagcaaaactatattgtccctattctttggcttaatgagactggt
accattggtgatgagaaggcggaaatgttcagaaatcaagtgactgggaaaataaacctc
cttggcctggtagaaatcgtcttgctcagtgttggtgtggtgatgtttattgctttcatg
atttcatattgtgcatgcagatcaaagggagtaaattaa

KEGG   Bubalus bubalis (water buffalo): 102394843Help
Entry
102394843         CDS       T05912                                 

Definition
(RefSeq) platelet glycoprotein 4
  KO
K06259  CD36 antigen
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04145  Phagosome
bbub04152  AMPK signaling pathway
bbub04512  ECM-receptor interaction
bbub04640  Hematopoietic cell lineage
bbub04920  Adipocytokine signaling pathway
bbub04931  Insulin resistance
bbub04975  Fat digestion and absorption
bbub04979  Cholesterol metabolism
bbub05144  Malaria
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102394843
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102394843
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102394843
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102394843
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102394843
   03320 PPAR signaling pathway
    102394843
  09154 Digestive system
   04975 Fat digestion and absorption
    102394843
   04979 Cholesterol metabolism
    102394843
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102394843
  09174 Infectious disease: parasitic
   05144 Malaria
    102394843
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102394843
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102394843
   04090 CD molecules [BR:bbub04090]
    102394843
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    102394843
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102394843
CD molecules [BR:bbub04090]
 Proteins
  102394843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD36
Motif
Other DBs
NCBI-GeneID: 102394843
NCBI-ProteinID: XP_006049754
LinkDB All DBs
Position
8
AA seq 472 aa AA seqDB search
MGCDRHCGLVTGAVIGAVVALFGGILMPVGDMLIERTIKKESVLEEGTIAFKNWVKAGAN
VYRQFWIFDVQNPEEVAVNSSKIKVKQRGPYTYRVRYLAKDIISQDSKTHTVSFQRPKGA
IFEPSLSVGTENDTFTVLNLAVAATPHLYPSTFVQIILNVFIKNSNSFMFQKRTLKELLW
GYKDPFLSSVPYSIPTTVGVFYPYNNTADGVYKVFNGKDDISKVARIDTYKGKKHLSYWP
SYCGMINGTDGATFPPFIEKNQVLQFFSADICRSFYAVFGAEINLKGIPVYRFVLPSRIF
ASPLQNPDNHCFCTEKIISKGCTLYGVLDISKCKEGKPVYVSLPHFLRASPEIAELIEGL
SPNEEEHSTYLDVEPVTGFTLQFAQRMQINILVKPAKNIVALKDLKHNYLVPILWLNETA
TIGDEKAEMFRNQVTGKINLLGLIEMILMSIGAVMFIAFTISYCACRLKNAK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgatcgacactgtgggctcgtcacgggcgctgtcattggagcagttgtggct
ctgttcggagggattctaatgccagttggagacatgctcattgagaggacaattaaaaag
gaatcggtccttgaagaaggtacaattgcttttaaaaattgggttaaagcaggtgctaac
gtttacagacagttttggatatttgatgtgcagaatccagaggaagtggcagtcaatagc
agcaaaattaaagttaagcaaagaggtccttacacatacagagtccgttatctagccaaa
gatattataagccaagactctaagacccacacagtctctttccaacggcccaaaggtgcc
atctttgaaccctcgctatcagttggaacagagaatgacacattcactgttctcaacctg
gctgtagcagctacaccccatctgtatccaagcacatttgttcagataatactgaatgta
tttatcaaaaactcaaactcttttatgtttcaaaagagaactctgaaagaactattgtgg
ggctataaggatccattcttgagttcggttccatactctattcctaccacagttggtgtg
ttttatccttacaacaatactgcagatggagtttataaagttttcaatggaaaagatgac
ataagcaaagttgccagaattgacacatataaaggcaaaaagcatctctcctattggcca
agttactgtggcatgattaatggtacagacggagccacatttccacctttcattgagaag
aatcaggtactacaattcttttccgctgacatttgcaggtcattttacgctgtgtttgga
gccgaaattaatctaaaaggaatccctgtgtatagatttgttcttccatccaggattttt
gcatctccacttcaaaatccagacaaccattgtttctgcacagaaaaaattatctccaag
ggttgcaccttatatggtgtgctagatattagcaaatgcaaagaaggaaaacctgtgtac
gtttcacttcctcattttctacgtgcaagtcctgaaattgcagaacttattgaaggctta
agtccaaatgaagaggaacatagcacatacttagatgttgaacctgtaactggattcact
ttacaatttgcacaacggatgcagatcaatatactagttaagccagcaaaaaatattgta
gcattaaaggatctgaagcacaactatttggtgcctattctttggcttaatgagactgcc
accattggtgatgagaaggcagaaatgttcagaaatcaagtgactggaaaaataaacctc
cttggcctgatagaaatgatcttaatgagtattggtgcagtgatgtttattgcttttaca
atatcatactgtgcatgtagattgaagaatgcaaaataa

DBGET integrated database retrieval system