KEGG   Bubalus bubalis (water buffalo): 102392639
Entry
102392639         CDS       T05912                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04151  PI3K-Akt signaling pathway
bbub04390  Hippo signaling pathway
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102392639 (YWHAB)
   04151 PI3K-Akt signaling pathway
    102392639 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102392639 (YWHAB)
   04114 Oocyte meiosis
    102392639 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102392639 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102392639 (YWHAB)
   05160 Hepatitis C
    102392639 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbub03400]
    102392639 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102392639 (YWHAB)
DNA repair and recombination proteins [BR:bbub03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102392639 (YWHAB)
Exosome [BR:bbub04147]
 Exosomal proteins
  Proteins found in most exosomes
   102392639 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 102392639
NCBI-ProteinID: XP_025119204
LinkDB
Position
14
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaagctcgctgagcaggccgagcgc
tacgatgacatggctgcggccatgaaggcggtcacggagcaggggcacgagctctccaac
gaggagagaaacctgctgtccgttgcctacaagaatgtggtcggcgcccgccgttcgtcc
tggcgtgtcatctccagcatcgaacagaaaactgagaggaacgagaagaagcagcagatg
ggcaaagagtaccgcgagaagatcgaggctgagctgcaggacatctgcaatgacgtgctg
gagctgttggataaataccttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggcgattattttagatatctttctgaggtggcttctggagacaataaa
caaaccactgtgtcgaactcccagcaggcttaccaagaagcatttgaaattagcaagaaa
gaaatgcagcctacacaccccattcgactggggctggcacttaatttctccgtcttttat
tatgagattctaaactcgcctgaaaaggcttgcagcctggcaaaaacggcgtttgatgag
gcgattgctgaattggacacactgaatgaagagtcttacaaagacagcaccctgattatg
cagctgcttagggacaatctcactctgtggacgtcggaaaaccagggagacgaaggagat
gctggggagggagagaactaa

KEGG   Bubalus bubalis (water buffalo): 102392926
Entry
102392926         CDS       T05912                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04151  PI3K-Akt signaling pathway
bbub04390  Hippo signaling pathway
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102392926 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    102392926 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102392926 (YWHAQ)
   04114 Oocyte meiosis
    102392926 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102392926 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102392926 (YWHAQ)
   05160 Hepatitis C
    102392926 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbub03400]
    102392926 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102392926 (YWHAQ)
DNA repair and recombination proteins [BR:bbub03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102392926 (YWHAQ)
Exosome [BR:bbub04147]
 Exosomal proteins
  Proteins found in most exosomes
   102392926 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 102392926
NCBI-ProteinID: XP_006073847
LinkDB
Position
12
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctgtcggtggcctacaagaacgtggtcgggggccgccggtccgcctggagg
gtcatctccagcatcgagcagaagaccgacacctcggacaagaagttgcagctgatcaag
gactaccgggagaaagtggagtccgagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattacttccggtaccttgctgaagttgcttgtggtgatgatcggaagcaa
acgatagataattcccaaggagcttaccaagaggctttcgatataagcaagaaagagatg
caacccacacaccccatccggctggggctggctcttaacttttctgtgttctactatgag
atcctcaataacccggaactggcctgcacactggctaaaacggcttttgatgaggctatt
gcagaactcgacacactgaatgaagactcgtacaaagacagcaccctcatcatgcagctg
ctgagagacaacctcacattatggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggcagaaaactaa

KEGG   Bubalus bubalis (water buffalo): 102397948
Entry
102397948         CDS       T05912                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon isoform X1
  KO
K06630  14-3-3 protein epsilon
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04151  PI3K-Akt signaling pathway
bbub04390  Hippo signaling pathway
bbub04621  NOD-like receptor signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub05160  Hepatitis C
bbub05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102397948 (YWHAE)
   04151 PI3K-Akt signaling pathway
    102397948 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102397948 (YWHAE)
   04114 Oocyte meiosis
    102397948 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102397948 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102397948 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102397948 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102397948 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbub03400]
    102397948 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102397948 (YWHAE)
DNA repair and recombination proteins [BR:bbub03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102397948 (YWHAE)
Exosome [BR:bbub04147]
 Exosomal proteins
  Proteins found in most exosomes
   102397948 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 102397948
NCBI-ProteinID: XP_006079841
LinkDB
Position
3
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggagtcaatgaagaaagtagcagggatggatgtggagttgacagttgaa
gaaagaaacctcctatctgttgcatataaaaatgtgattggagctagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaaactaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacagggaatgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacacatcccattcgcttaggtcttgccctcaacttttctgtattc
tactatgaaattcttaattccccggaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggacacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

KEGG   Bubalus bubalis (water buffalo): 102399947
Entry
102399947         CDS       T05912                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta isoform X2
  KO
K16198  14-3-3 protein gamma/eta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04151  PI3K-Akt signaling pathway
bbub04390  Hippo signaling pathway
bbub05160  Hepatitis C
bbub05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102399947 (YWHAH)
   04151 PI3K-Akt signaling pathway
    102399947 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102399947 (YWHAH)
   04114 Oocyte meiosis
    102399947 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102399947 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102399947 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bbub01009]
    102399947 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbub03400]
    102399947 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102399947 (YWHAH)
Protein phosphatases and associated proteins [BR:bbub01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102399947 (YWHAH)
DNA repair and recombination proteins [BR:bbub03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102399947 (YWHAH)
Exosome [BR:bbub04147]
 Exosomal proteins
  Proteins found in most exosomes
   102399947 (YWHAH)
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 102399947
NCBI-ProteinID: XP_006051063
LinkDB
Position
17
AA seq 233 aa
MTDVPYATSVTWRRMSVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMAD
GNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRY
LAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQA
CLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
NT seq 702 nt   +upstreamnt  +downstreamnt
atgactgatgttccatatgctaccagcgtcacctggaggaggatgtcggtgactgagctc
aatgaacctctctccaacgaagaccggaacctcctctccgtggcctacaagaatgtggtt
ggtgcccggcggtcttcctggagggtcatcagcagcatcgagcagaagaccatggctgat
gggaatgagaagaagctggagaaggtgaaggcctaccgggagaagattgagaaggagctg
gagacggtgtgcaacgacgtgctggcgctgctggacaagttcctcatcaagaactgcaat
gacttccagtacgagagcaaggtcttctacctgaagatgaagggcgactactaccgctac
ctggccgaggtggcttctggcgagaagaagaacagtgtggtggaggcctcagaggcggcc
tacaaggaagccttcgagattagcaaggagcacatgcagcccacacaccccatccggctg
ggcctggccctcaacttctccgtgttctactacgagatccagaatgcgcctgagcaggcc
tgcctcctagccaaacaagccttcgacgacgccatagccgagctggacacactaaacgag
gattcctataaggactccacgctcatcatgcagctgctgcgagacaacctcaccctctgg
acgagcgaccagcaggacgaggaagccggagaaggcaactga

KEGG   Bubalus bubalis (water buffalo): 102407021
Entry
102407021         CDS       T05912                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04151  PI3K-Akt signaling pathway
bbub04390  Hippo signaling pathway
bbub05160  Hepatitis C
bbub05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102407021 (YWHAG)
   04151 PI3K-Akt signaling pathway
    102407021 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102407021 (YWHAG)
   04114 Oocyte meiosis
    102407021 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102407021 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102407021 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bbub01009]
    102407021 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbub03400]
    102407021 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102407021 (YWHAG)
Protein phosphatases and associated proteins [BR:bbub01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102407021 (YWHAG)
DNA repair and recombination proteins [BR:bbub03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102407021 (YWHAG)
Exosome [BR:bbub04147]
 Exosomal proteins
  Proteins found in most exosomes
   102407021 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 102407021
NCBI-ProteinID: XP_006057193
LinkDB
Position
24
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggcggagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacggagctgaatgagccactgtccaatgaa
gaaagaaaccttctctctgtggcctacaagaatgtagtcggggcacgccgttcttcctgg
agggttatcagtagcatcgagcagaagacatctgctgacggtaacgagaagaaaatagag
atggtccgtgcttaccgtgaaaaaatagagaaggagttggaggccgtatgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagcgagacccagtatgagagcaaa
gtgttttacctgaagatgaaaggggactattaccgctacctggccgaagttgccaccggc
gagaagagggcaaccgtcgtggagtcatctgagaaggcctacagcgaagcccacgagatc
agcaaggagcacatgcagcccactcaccccattagattaggcctggcccttaactactcc
gtcttctactacgagatccagaacgccccggagcaagcctgccacttggccaagaccgcc
ttcgacgatgccatcgccgagctcgacaccctcaacgaggactcctacaaggactccacg
ctgatcatgcagctgctccgtgacaacctcacgctctggacgagcgaccagcaagacgac
gacggcggcgaaggcaacaattaa

KEGG   Bubalus bubalis (water buffalo): 102415951
Entry
102415951         CDS       T05912                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04110  Cell cycle
bbub04114  Oocyte meiosis
bbub04151  PI3K-Akt signaling pathway
bbub04390  Hippo signaling pathway
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102415951 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    102415951 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102415951 (YWHAZ)
   04114 Oocyte meiosis
    102415951 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102415951 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102415951 (YWHAZ)
   05160 Hepatitis C
    102415951 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbub03400]
    102415951 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102415951 (YWHAZ)
DNA repair and recombination proteins [BR:bbub03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102415951 (YWHAZ)
Exosome [BR:bbub04147]
 Exosomal proteins
  Proteins found in most exosomes
   102415951 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 102415951
NCBI-ProteinID: XP_006046494
LinkDB
Position
15
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaacgagctggtacagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctccagtattgagcaaaagacggaaggagctgagaaaaaacagcagatggctcga
gaatacagagagaaaatagagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaacgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgctacttggctgaggttgcagctggtgatgacaagaaaggg
attgtggatcagtcgcagcaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctactatgag
attctgaactcccctgagaaagcctgctctcttgcaaagacagcatttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcagtta
ctgagagataacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

DBGET integrated database retrieval system