KEGG   Bubalus bubalis (water buffalo): 102392863
Entry
102392863         CDS       T05912                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X1
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04068  FoxO signaling pathway
bbub04270  Vascular smooth muscle contraction
bbub04650  Natural killer cell mediated cytotoxicity
bbub04720  Long-term potentiation
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102392863 (ARAF)
   04012 ErbB signaling pathway
    102392863 (ARAF)
   04068 FoxO signaling pathway
    102392863 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102392863 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102392863 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102392863 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    102392863 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102392863 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102392863 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102392863 (ARAF)
   04720 Long-term potentiation
    102392863 (ARAF)
   04730 Long-term depression
    102392863 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102392863 (ARAF)
   05205 Proteoglycans in cancer
    102392863 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102392863 (ARAF)
   05212 Pancreatic cancer
    102392863 (ARAF)
   05225 Hepatocellular carcinoma
    102392863 (ARAF)
   05226 Gastric cancer
    102392863 (ARAF)
   05214 Glioma
    102392863 (ARAF)
   05221 Acute myeloid leukemia
    102392863 (ARAF)
   05220 Chronic myeloid leukemia
    102392863 (ARAF)
   05218 Melanoma
    102392863 (ARAF)
   05211 Renal cell carcinoma
    102392863 (ARAF)
   05219 Bladder cancer
    102392863 (ARAF)
   05215 Prostate cancer
    102392863 (ARAF)
   05213 Endometrial cancer
    102392863 (ARAF)
   05224 Breast cancer
    102392863 (ARAF)
   05223 Non-small cell lung cancer
    102392863 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102392863 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    102392863 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    102392863 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102392863 (ARAF)
   05160 Hepatitis C
    102392863 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102392863 (ARAF)
   01522 Endocrine resistance
    102392863 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102392863 (ARAF)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102392863 (ARAF)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102392863 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 102392863
NCBI-ProteinID: XP_006058624
LinkDB
Position
X
AA seq 611 aa
MEPPRGPPANGAEPSRSVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSVQDLSGSSRQHEVPSNRPLNEPL
TPQSPSLSPASSCTQHRDPEHFSFPAQANTPLQRIRSTSTPNVHMVSTTAPMDSGLIQLT
GQNFNTDAAGNRGGGDGAPRGSPSPASVSSGRKSPHSKSPSEQRERKSLADDKKKVKNLG
YRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEM
QVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQ
GMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAA
EVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIS
SNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELP
ACLLSAARLAP
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgctaacggggccgagccctcccggtcagtgggcacc
gtcaaagtgtacctgcccaacaagcagcgcacggtggtgactgtccgggatggcatgagt
gtctatgactctctagacaaggccctcaaggtgcggggtctcaatcaagattgctgtgtg
gtttaccggctcatcaaggggcgaaagacagtcaccgcctgggacacagccattgctccc
ctggatggcgaggagctcattgtggaggtcctcgaagatgtccccctgaccatgcacaat
tttgtacggaagacgttcttcagcctggccttttgtgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggatacaagttccaccaacattgttcctccaaggtc
cccacagtctgtgtcgacatgagtaccaaccgccgacagttctaccacagtgtccaggat
ttgtccggaagctccagacagcacgaggttccctcaaaccgccccctgaatgagccgctc
acccctcagagtcccagcctttcccctgccagctcctgcacccagcaccgcgaccccgag
cacttctccttccctgcccaggccaacacccccctccagcgcatccgttccacatccacc
cccaatgtccacatggtcagcaccacagcccccatggactccggcctcatccagcttact
ggccagaatttcaacactgatgctgctgggaatagaggtggtggcgatggagccccccgg
gggagccccagcccagccagcgtgtcctctggaaggaagtccccacattccaagtcccca
tcagagcagcgggaacgaaagtcattggctgatgacaagaagaaagtgaagaatttgggg
taccgggactcgggctattactgggaggtgccacccagtgaggtgcagttgctgaagagg
atcgggacaggctcgtttggcaccgtgtttcgcgggcggtggcatggcgatgtggctgtg
aaggtgctcaaggtggcccaacccacagctgagcaggcccaggccttcaagaacgagatg
caggtgctcaggaagacacgtcacgtcaacatcttgctgttcatgggcttcatgacccgg
ccaggatttgccatcatcacacagtggtgtgagggctccagtctctaccaccacctgcat
gtggctgacacacgcttcgacatggtccagctcattgatgtggcccgccagactgctcag
ggcatggactacctccatgccaagaacatcatccaccgagatctcaagtctaacaacatc
ttcctgcatgaggggctcacggtgaagatcggggacttcggcctggctacagtaaagacg
cggtggagtggggcccagcccttggagcaaccctcgggctctgtgctatggatggcagct
gaggtgatccgtatgcaggacccgaacccctacagcttccagtcagatgtctacgcctat
ggggttgtgctctatgagctcatgaccggctcactgccttacagccacattggcagccga
gaccagattatctttatggtgggccgtggctatctgtccccggacctcagcaaaatctcc
agcaattgccccaaggccatgaggcgcctgctgtctgactgcctgaagttccagcgggag
gagcggcccctttttccccagatcctggccacgattgagctgctgcagcggtcactcccc
aagattgagcggagtgcctccgaaccctccttgcaccgtacccaggctgatgagttgcct
gcctgcctactcagcgcagcccgccttgcgccttag

KEGG   Bubalus bubalis (water buffalo): 102401079
Entry
102401079         CDS       T05912                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X4
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04015  Rap1 signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04150  mTOR signaling pathway
bbub04270  Vascular smooth muscle contraction
bbub04510  Focal adhesion
bbub04650  Natural killer cell mediated cytotoxicity
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04934  Cushing syndrome
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102401079 (BRAF)
   04012 ErbB signaling pathway
    102401079 (BRAF)
   04015 Rap1 signaling pathway
    102401079 (BRAF)
   04068 FoxO signaling pathway
    102401079 (BRAF)
   04024 cAMP signaling pathway
    102401079 (BRAF)
   04150 mTOR signaling pathway
    102401079 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102401079 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102401079 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102401079 (BRAF)
   04062 Chemokine signaling pathway
    102401079 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102401079 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102401079 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102401079 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102401079 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102401079 (BRAF)
   04720 Long-term potentiation
    102401079 (BRAF)
   04730 Long-term depression
    102401079 (BRAF)
   04722 Neurotrophin signaling pathway
    102401079 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401079 (BRAF)
   05205 Proteoglycans in cancer
    102401079 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102401079 (BRAF)
   05212 Pancreatic cancer
    102401079 (BRAF)
   05225 Hepatocellular carcinoma
    102401079 (BRAF)
   05226 Gastric cancer
    102401079 (BRAF)
   05214 Glioma
    102401079 (BRAF)
   05216 Thyroid cancer
    102401079 (BRAF)
   05221 Acute myeloid leukemia
    102401079 (BRAF)
   05220 Chronic myeloid leukemia
    102401079 (BRAF)
   05218 Melanoma
    102401079 (BRAF)
   05211 Renal cell carcinoma
    102401079 (BRAF)
   05219 Bladder cancer
    102401079 (BRAF)
   05215 Prostate cancer
    102401079 (BRAF)
   05213 Endometrial cancer
    102401079 (BRAF)
   05224 Breast cancer
    102401079 (BRAF)
   05223 Non-small cell lung cancer
    102401079 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102401079 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    102401079 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    102401079 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102401079 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102401079 (BRAF)
   05160 Hepatitis C
    102401079 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102401079 (BRAF)
   01522 Endocrine resistance
    102401079 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102401079 (BRAF)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102401079 (BRAF)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102401079 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 102401079
NCBI-ProteinID: XP_006078854
LinkDB
Position
8
AA seq 765 aa
MAALSGGGGGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTS
SSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASLAETTLPCGSSPSAPPSDSIGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLSNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggtggcggcggcggcggcggcgcggagcagggccaggctctg
ttcaatggggacatggagcccgaggccggcgccgcggcctcttcggctgcggaccccgcc
attcccgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagag
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaagctagatgccctccaacaaagagaacaacagttattggaatcc
ctggggaatggaactgatttttctgtttctagctctgcatcaacggacaccgttacatct
tcttcctcttctagcctttcagtgctgccttcatctctttcagtttttcaaaatcccaca
gatgtgtcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aataaacagaggacagtggtacctgcacggtgtggagtcacagtccgggacagcctgaag
aaggcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggggagaagaaaccaattggctgggacactgatatttcctggcttactggagaggagttg
catgtagaagtgttggagaatgttccacttacaacacacaactttgtacggaaaactttt
ttcaccttagcattttgtgacttctgtagaaagctgcttttccaggggttccgctgtcaa
acatgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaactagatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaggaggcctccttagcagagactacccttccatgtggctcatctccttctgcacccccc
tccgattctattgggcccccaattctcaccagtccatctccttcaaaatccattccaatt
ccacagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccgg
tcctcatcagctccaaatgtgcatataaacacaatagaacccgtcaatattgatgacttg
attagagaccaagggtttcgtagtgatggaggatcaaccacaggtttatccgccacaccc
cctgcctcattacctggctcactctctaatgtgaaagcattgcagaaatctccaggacct
cagcgagaaagaaagtcctcttcatcctcagaagataggaatcgaatgaaaacgcttggt
agacgggattcaagtgacgattgggagattcctgatggacagatcacagtgggacaaaga
attggatcagggtcatttgggacggtctacaagggaaagtggcatggtgatgtggcagtg
aaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagta
ggagtactcaggaaaacgcgacatgtgaatatcctcctcttcatgggttattcaacaaag
ccacaactggctattgttacccagtggtgtgagggctccagtttatatcatcatctccac
atcattgagaccaaattcgagatgatcaaacttatagatattgcacggcagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatt
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtaatcagaatgcaagataaaaacccatatagctttcagtcagatgtatatgcattt
gggattgttctgtatgaattgatgaccggacagttaccttattcaaatatcaacaacagg
gaccagataatttttatggtgggacgaggatatctgtctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctaaaaaagaaaagagat
gaaagaccactctttccccaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaacagaggat
tttagtctatatgcttgtgcttctccaaaaacacccattcaggcagggggatatggagaa
tttgcagccttcaagtag

KEGG   Bubalus bubalis (water buffalo): 102412922
Entry
102412922         CDS       T05912                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04218  Cellular senescence
bbub04270  Vascular smooth muscle contraction
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04510  Focal adhesion
bbub04540  Gap junction
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04613  Neutrophil extracellular trap formation
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04929  GnRH secretion
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05132  Salmonella infection
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102412922 (RAF1)
   04012 ErbB signaling pathway
    102412922 (RAF1)
   04014 Ras signaling pathway
    102412922 (RAF1)
   04015 Rap1 signaling pathway
    102412922 (RAF1)
   04370 VEGF signaling pathway
    102412922 (RAF1)
   04371 Apelin signaling pathway
    102412922 (RAF1)
   04630 JAK-STAT signaling pathway
    102412922 (RAF1)
   04068 FoxO signaling pathway
    102412922 (RAF1)
   04072 Phospholipase D signaling pathway
    102412922 (RAF1)
   04071 Sphingolipid signaling pathway
    102412922 (RAF1)
   04024 cAMP signaling pathway
    102412922 (RAF1)
   04022 cGMP-PKG signaling pathway
    102412922 (RAF1)
   04151 PI3K-Akt signaling pathway
    102412922 (RAF1)
   04150 mTOR signaling pathway
    102412922 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102412922 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    102412922 (RAF1)
   04218 Cellular senescence
    102412922 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102412922 (RAF1)
   04540 Gap junction
    102412922 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102412922 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102412922 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102412922 (RAF1)
   04625 C-type lectin receptor signaling pathway
    102412922 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    102412922 (RAF1)
   04660 T cell receptor signaling pathway
    102412922 (RAF1)
   04662 B cell receptor signaling pathway
    102412922 (RAF1)
   04664 Fc epsilon RI signaling pathway
    102412922 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    102412922 (RAF1)
   04062 Chemokine signaling pathway
    102412922 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102412922 (RAF1)
   04929 GnRH secretion
    102412922 (RAF1)
   04912 GnRH signaling pathway
    102412922 (RAF1)
   04915 Estrogen signaling pathway
    102412922 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    102412922 (RAF1)
   04917 Prolactin signaling pathway
    102412922 (RAF1)
   04921 Oxytocin signaling pathway
    102412922 (RAF1)
   04926 Relaxin signaling pathway
    102412922 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    102412922 (RAF1)
   04919 Thyroid hormone signaling pathway
    102412922 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    102412922 (RAF1)
   04916 Melanogenesis
    102412922 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102412922 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    102412922 (RAF1)
   04720 Long-term potentiation
    102412922 (RAF1)
   04730 Long-term depression
    102412922 (RAF1)
   04722 Neurotrophin signaling pathway
    102412922 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    102412922 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102412922 (RAF1)
   05206 MicroRNAs in cancer
    102412922 (RAF1)
   05205 Proteoglycans in cancer
    102412922 (RAF1)
   05230 Central carbon metabolism in cancer
    102412922 (RAF1)
   05231 Choline metabolism in cancer
    102412922 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102412922 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102412922 (RAF1)
   05212 Pancreatic cancer
    102412922 (RAF1)
   05225 Hepatocellular carcinoma
    102412922 (RAF1)
   05226 Gastric cancer
    102412922 (RAF1)
   05214 Glioma
    102412922 (RAF1)
   05221 Acute myeloid leukemia
    102412922 (RAF1)
   05220 Chronic myeloid leukemia
    102412922 (RAF1)
   05218 Melanoma
    102412922 (RAF1)
   05211 Renal cell carcinoma
    102412922 (RAF1)
   05219 Bladder cancer
    102412922 (RAF1)
   05215 Prostate cancer
    102412922 (RAF1)
   05213 Endometrial cancer
    102412922 (RAF1)
   05224 Breast cancer
    102412922 (RAF1)
   05223 Non-small cell lung cancer
    102412922 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102412922 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102412922 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    102412922 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102412922 (RAF1)
   05152 Tuberculosis
    102412922 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102412922 (RAF1)
   05161 Hepatitis B
    102412922 (RAF1)
   05160 Hepatitis C
    102412922 (RAF1)
   05164 Influenza A
    102412922 (RAF1)
   05163 Human cytomegalovirus infection
    102412922 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102412922 (RAF1)
   05165 Human papillomavirus infection
    102412922 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102412922 (RAF1)
   01522 Endocrine resistance
    102412922 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102412922 (RAF1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102412922 (RAF1)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102412922 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 102412922
NCBI-ProteinID: XP_006078984
LinkDB
Position
21
AA seq 668 aa
MEHIQGAWKTISNGFGFKDTVFDGTSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDGGVPALPSLTMRRMRESVSRIPPGSQHRYSTPHAFTF
STSSPSSEGSLSQRQRSTSTPNVHMVSATLPVDSRMIENNSLNASPRAWSRRFCVRGRDA
IRSHSESGSPSALSSSPNNLSPTGWSQPKTPAPAQRERAPGSSTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggtgcctggaagacgatcagcaacggtttcggattcaaagacacg
gtgtttgacggcaccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcgtcagatgacggcaaacttacggacccttctaagacaagcaacactatccgtgtg
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaatggaatgagcttgcatgac
tgcctcatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaagggtaaaaaagcacggttagattggaatactgatgctgcctcg
ttgatcggagaggaacttcaagtggattttctggatcatgttcccctcacaacacacaac
tttgctcggaaaaccttcctgaagcttgccttctgtgacatctgtcagaagttcttgcta
aatggatttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cccactatgtgtgtggactggagtaatatcagacagctcttattgttcccaaattccact
gttggtgatggcggggtcccagcgctgccttctttgacgatgcgtcggatgcgagagtct
gtttcccggatacctcctggttcccagcacagatactccacaccccacgctttcacattc
agcacctccagcccctcctctgaaggctccctctcccagaggcagaggtcgacgtccacg
cccaatgtgcacatggtcagcgccaccctgcctgtggatagcaggatgatcgagaataac
agcctgaatgcttctcccagggcgtggtccagacgattttgtgtgaggggaagagatgca
attcgaagtcacagtgaatcaggctccccttcagccttgtccagcagtcccaacaatctg
agcccgacaggctggtcacagcccaaaacccctgcgcctgcacagagagagcgggcgcca
ggctccagcacccaggagaagaacaaaattaggcctcgtggacagagagattcgagctat
tactgggagatagaagccagtgaagtgatgctgtccactcggattggatcaggctccttc
gggactgtttataagggcaagtggcatggagatgttgcagtcaagattctgaaggtcgtt
gaccccaccccagagcagttccaggccttcaggaatgaggtggctgtcctccgcaaaacc
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcgatagtg
acccagtggtgtgagggcagcagcctctacaaacacctgcacgtccaggagaccaagttc
cagatgttccagctgattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaataatatatttctccatgaaggcctg
acggtgaaaatcggtgattttggattggccacggtgaagtcgcgctggagtggttctcag
caggtcgagcagcccaccggctccatcctgtggatggccccagaggtgatccggatgcag
gataataacccgttcagcttccagtctgacgtctactcctacggcatcgtgctgtatgag
ctcatgacgggggagctcccttattcccacatcaacaaccgcgaccagatcatcttcatg
gtgggccgcgggtacgcctccccagacctcagcaagctctacaagaactgccccaaagcc
atgaagaggctggtagctgactgcgtgaagaaagtgaaggaagaaaggcctctttttccc
cagatcctgtcttccatcgagctgcttcagcactctctgcccaagatcaaccggagtgcc
tcggagccctccctgcaccgggcggcccacaccgaggacatcaacgcctgcacgctgacc
acgtcccctcggctgcctgtcttctag

DBGET integrated database retrieval system