KEGG   Bubalus bubalis (water buffalo): 102392913
Entry
102392913         CDS       T05912                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04510  Focal adhesion
bbub04540  Gap junction
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04714  Thermogenesis
bbub04722  Neurotrophin signaling pathway
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04935  Growth hormone synthesis, secretion and action
bbub05034  Alcoholism
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102392913 (SOS1)
   04012 ErbB signaling pathway
    102392913 (SOS1)
   04014 Ras signaling pathway
    102392913 (SOS1)
   04630 JAK-STAT signaling pathway
    102392913 (SOS1)
   04068 FoxO signaling pathway
    102392913 (SOS1)
   04072 Phospholipase D signaling pathway
    102392913 (SOS1)
   04151 PI3K-Akt signaling pathway
    102392913 (SOS1)
   04150 mTOR signaling pathway
    102392913 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102392913 (SOS1)
   04540 Gap junction
    102392913 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102392913 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102392913 (SOS1)
   04660 T cell receptor signaling pathway
    102392913 (SOS1)
   04662 B cell receptor signaling pathway
    102392913 (SOS1)
   04664 Fc epsilon RI signaling pathway
    102392913 (SOS1)
   04062 Chemokine signaling pathway
    102392913 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102392913 (SOS1)
   04912 GnRH signaling pathway
    102392913 (SOS1)
   04915 Estrogen signaling pathway
    102392913 (SOS1)
   04917 Prolactin signaling pathway
    102392913 (SOS1)
   04926 Relaxin signaling pathway
    102392913 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    102392913 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102392913 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102392913 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102392913 (SOS1)
   05206 MicroRNAs in cancer
    102392913 (SOS1)
   05205 Proteoglycans in cancer
    102392913 (SOS1)
   05231 Choline metabolism in cancer
    102392913 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102392913 (SOS1)
   05225 Hepatocellular carcinoma
    102392913 (SOS1)
   05226 Gastric cancer
    102392913 (SOS1)
   05214 Glioma
    102392913 (SOS1)
   05221 Acute myeloid leukemia
    102392913 (SOS1)
   05220 Chronic myeloid leukemia
    102392913 (SOS1)
   05211 Renal cell carcinoma
    102392913 (SOS1)
   05215 Prostate cancer
    102392913 (SOS1)
   05213 Endometrial cancer
    102392913 (SOS1)
   05224 Breast cancer
    102392913 (SOS1)
   05223 Non-small cell lung cancer
    102392913 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    102392913 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102392913 (SOS1)
   05160 Hepatitis C
    102392913 (SOS1)
   05163 Human cytomegalovirus infection
    102392913 (SOS1)
   05165 Human papillomavirus infection
    102392913 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102392913 (SOS1)
   01522 Endocrine resistance
    102392913 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bbub04990]
    102392913 (SOS1)
Domain-containing proteins not elsewhere classified [BR:bbub04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102392913 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 102392913
NCBI-ProteinID: XP_006071264
LinkDB
Position
12
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENVQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYNYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKSTDEVPVPPPVPPRRRPESAPAESSPSKMMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggttcaggggcaagttcatccaactcttgagtcc
agtgatgatgctcttcagtatgttgaagaattaattttgcaactgttaaatatgctatgc
caagctcaaccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaatccatcctttgttaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattatgtgcgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgtg
gaagatataaatatattatctttaactgatgaagaaccttccacctcaggagagcagact
tactatgatttggtaaaagcatttatggcagaaattcgacaatacataagggaacttaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgtatagtggatatacatgaacttagtgtaaaattactg
ggccatatagaagatactgtggaaatgacagatgaaggcagtccccatccattagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattctacgacctggttttcacgatcgtttccttagtcagttatcaaagcctggagca
gcgctctatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctagcccctgtttaccactgtctgcattacttcgaacttctgaagcagtta
gaagaaaagagtgaggatcaagaagacaaagaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactt
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactcttacacgtgtaggagccaaacatgagagacat
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagacta
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaagaacaattggatggcagca
ttgatatctttacagtaccggagtaccctggaaagaatgcttgatgtgaccatgctgcag
gaagaaaaggaggagcagatgaggctccctagtgctgacgtttatagatttgcagagcct
gactctgaagaaaatatcatatttgaagaaaacgtgcagcccaaagctggaattccaatt
atcaaggcaggaaccgttattaaacttatagagaggctcacataccacatgtatgcagat
cccaattttgttcggacatttcttacaacatatagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggggatcaacccttgagtgcagaactaaaaagatttagaaaagaa
tatatacagcctgtgcagctgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctatgattttgaaagagatgcagatcttttgcagcgaatggaggaatttattggaacc
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgccagagacaatggaccaggtcataatattacatttcagagttcacctcctacg
gttgagtggcatataagcagacctgggcacatcgagacttttgacctgctcactttacac
ccaatagaaattgctcgacaactcactttacttgaatcagacctatatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcataccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctacaa
gtgttccaagagctcaacaacttcaatggtgttcttgaagttgtcagtgctatgaactca
tcccctgtttacagactagaccacacgtttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaactaagtgaagatcactataaaaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctcactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaacggcatggaaaagagcttataaactttagtaaa
aggaggaaagtagcagaaataacaggcgagatccagcagtaccaaaatcagccttactgt
ttacgagtagagtcagatatcaaaaggttttttgaaaacttgaatccaatgggaaatagc
atggaaaaagaatttacggattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctcttccaagatttccaaaaaaatacaactatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtactatgagacatcccacacctctgcagcaagagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagagcactgatgaagtgcctgtcccccctcctgttcctccacgaagacggccagag
tctgccccagcggaatcttcgccatctaagatgatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagcctattcaccacggtattcaatatcagac
cggacctctatatcagaccctcctgaaagccctcccttattacctccacgagaacccgtg
aggacacctgatgttttctcaagttcaccactacatctccaacctccccctctgggcaaa
aaaagtgaccatagtaatgccttcttcccaaacagcccctccccctttacaccacctcct
cctcaaacaccttctcctcacggaacaagaaggcatctgccgtcaccaccactgacacaa
gaagtggacctccattccattgctgggccgcctgttcctccacgacaaagcacttctcag
catatccctaaactccctccaaaaacttacaaaagggagcacacccacccgtccatgcac
agagacggaccaccactgttggagaatgcccattcttcctga

KEGG   Bubalus bubalis (water buffalo): 102412823
Entry
102412823         CDS       T05912                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04510  Focal adhesion
bbub04540  Gap junction
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04714  Thermogenesis
bbub04722  Neurotrophin signaling pathway
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04935  Growth hormone synthesis, secretion and action
bbub05034  Alcoholism
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102412823 (SOS2)
   04012 ErbB signaling pathway
    102412823 (SOS2)
   04014 Ras signaling pathway
    102412823 (SOS2)
   04630 JAK-STAT signaling pathway
    102412823 (SOS2)
   04068 FoxO signaling pathway
    102412823 (SOS2)
   04072 Phospholipase D signaling pathway
    102412823 (SOS2)
   04151 PI3K-Akt signaling pathway
    102412823 (SOS2)
   04150 mTOR signaling pathway
    102412823 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102412823 (SOS2)
   04540 Gap junction
    102412823 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102412823 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102412823 (SOS2)
   04660 T cell receptor signaling pathway
    102412823 (SOS2)
   04662 B cell receptor signaling pathway
    102412823 (SOS2)
   04664 Fc epsilon RI signaling pathway
    102412823 (SOS2)
   04062 Chemokine signaling pathway
    102412823 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102412823 (SOS2)
   04912 GnRH signaling pathway
    102412823 (SOS2)
   04915 Estrogen signaling pathway
    102412823 (SOS2)
   04917 Prolactin signaling pathway
    102412823 (SOS2)
   04926 Relaxin signaling pathway
    102412823 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    102412823 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102412823 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102412823 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102412823 (SOS2)
   05206 MicroRNAs in cancer
    102412823 (SOS2)
   05205 Proteoglycans in cancer
    102412823 (SOS2)
   05231 Choline metabolism in cancer
    102412823 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102412823 (SOS2)
   05225 Hepatocellular carcinoma
    102412823 (SOS2)
   05226 Gastric cancer
    102412823 (SOS2)
   05214 Glioma
    102412823 (SOS2)
   05221 Acute myeloid leukemia
    102412823 (SOS2)
   05220 Chronic myeloid leukemia
    102412823 (SOS2)
   05211 Renal cell carcinoma
    102412823 (SOS2)
   05215 Prostate cancer
    102412823 (SOS2)
   05213 Endometrial cancer
    102412823 (SOS2)
   05224 Breast cancer
    102412823 (SOS2)
   05223 Non-small cell lung cancer
    102412823 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    102412823 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102412823 (SOS2)
   05160 Hepatitis C
    102412823 (SOS2)
   05163 Human cytomegalovirus infection
    102412823 (SOS2)
   05165 Human papillomavirus infection
    102412823 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102412823 (SOS2)
   01522 Endocrine resistance
    102412823 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bbub04990]
    102412823 (SOS2)
Domain-containing proteins not elsewhere classified [BR:bbub04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102412823 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 102412823
NCBI-ProteinID: XP_006063211
LinkDB
Position
11
AA seq 1332 aa
MQQAPQPYEFYSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKI
RSEEHEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
CSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIYAAKSAEEKNNWMAALI
SLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
LEKGEQPISTDLKRFRKEYVQPVQLRVLNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRRVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
DAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGCASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSAFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDQDASNSKGTMKSDDDPPAIPPRQPPPPKVKPRVPAPTGPFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLSSSQNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPVY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccttacgagttctacagcgaagagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattacattgaagagctgatttttcagctgcttaataaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaaagaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccatgtatccctgtatattgtggctgtgctggagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatctcaacaa
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctttgtgaagatgaacctagttcttcaggcgaattaaactactat
gatcttgttagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttctttctgacagaaagctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgaattgactgtgaaacttttaggttta
attgaagacacagttgaaatgactgatgaaagtagccctcatcccttagctggcagctgt
tttgaagatctggcagaggagcaagcatttgatccttatgaaacattatcccaggatatt
ctttcaccaaagtttaatgaacattttagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgccagtatatcattgttggcactattttgaattattaaagcaattgaaaata
cgtagtgaagagcatgaagacagagaatgtttgaaccaagctattactgctctcatgaat
ctccaaggtagtatggaccgaatttacaagcagtattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaatttattatggaaggcccattgacaagaattggtgctaaacatgaacggcatattttt
ctctttgatggcttaatgattagctgcaaacccaatcacagccagtcacgccttccagga
tgcagtagtgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtgcaaacatgcttttgaattagtatccaaagatgaaaac
agcataatatatgctgctaagtctgctgaagagaaaaataattggatggcagcacttatt
tcccttcagtatcgtagtactcttgatcgaatgctagattcagtattattgaaggaagaa
aatgaacaaccattgagattaccaagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcagagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggctaacatatcatatgtacgcagatcccaat
tttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattactaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggcg
ttagaaaaaggcgagcagcccatcagtacagaccttaaaaggtttcgcaaggaatacgtc
caaccagtacaacttagggtcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagacttggagctgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaaaaaacaa
gctcaggcaaatggtataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacccttttggaatctgatctctacaggagagttcaaccttct
gaacttgtagggagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccacaccacaaatctcaccctctggtttgaaaaatgcattgtggaggca
gaaaattttgaggaacgagtggcaatactgagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattggagatcgtcagtgcagtaaattcagtatca
gtctatagactagatcatacctttgaggcgttgcaggaaagaaaaaggaaaattttggat
gatgctgtggaattaagtcaagatcattttaaaaaatatctagtgaaacttaagtcaatc
aatccaccctgtgtgcctttttttggaatatatttaacaaatatactgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcaaaatcaaccttactgtttacgg
atagaaccagaaatgaggagattctttgaaaaccttaaccccatgggatgtgcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaattgcaaa
cagccacctcgatttcctaggaaatcagctttctccttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggtactttgcgaggtcacccaacaccattagaa
agagaaccatgtaaaataagctttagtcggattgctgaaacggagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctaccccgccagtgtctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggaagcaatagcatctttgcccca
gtcctcttgcctcattcaaagtctttcttcagttcgtgtggtagtttacataagctaagt
gaagagccactgattcctcctccacttccacctcgaaaaaaatttgatcaggatgcttca
aattccaagggaactatgaaatctgatgatgacccccctgctattccaccaagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtccatttgacgggcctctg
catagtccacctccaccgccgccgagagatcctcttcctgatacccctccaccggttcca
cttcggcctccagaacactttataaactgtccgtttacccttcagccacctccactggga
catcttcacagagatccagactggttcagagacgttagtacgtgtccaaattctccgaac
actcctcctagcacaccctctccaagggtacctcgtcgatgctatgtgctcagttctagt
caaaataatcttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
catctaccaaaactgccaccaaagacttacaaacgggagctttcacaccccccagtgtat
agactgcctttgttagaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system