KEGG   Bubalus bubalis (water buffalo): 102392963
Entry
102392963         CDS       T05912                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X3
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04022  cGMP-PKG signaling pathway
bbub04141  Protein processing in endoplasmic reticulum
bbub04151  PI3K-Akt signaling pathway
bbub04211  Longevity regulating pathway
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04668  TNF signaling pathway
bbub04728  Dopaminergic synapse
bbub04911  Insulin secretion
bbub04915  Estrogen signaling pathway
bbub04918  Thyroid hormone synthesis
bbub04925  Aldosterone synthesis and secretion
bbub04926  Relaxin signaling pathway
bbub04927  Cortisol synthesis and secretion
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04934  Cushing syndrome
bbub04935  Growth hormone synthesis, secretion and action
bbub05020  Prion disease
bbub05030  Cocaine addiction
bbub05031  Amphetamine addiction
bbub05034  Alcoholism
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102392963 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102392963 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102392963 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102392963 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102392963 (ATF6B)
   04915 Estrogen signaling pathway
    102392963 (ATF6B)
   04926 Relaxin signaling pathway
    102392963 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102392963 (ATF6B)
   04918 Thyroid hormone synthesis
    102392963 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102392963 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102392963 (ATF6B)
   04927 Cortisol synthesis and secretion
    102392963 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102392963 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102392963 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102392963 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102392963 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102392963 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102392963 (ATF6B)
   05031 Amphetamine addiction
    102392963 (ATF6B)
   05034 Alcoholism
    102392963 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102392963 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102392963 (ATF6B)
   05161 Hepatitis B
    102392963 (ATF6B)
   05163 Human cytomegalovirus infection
    102392963 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102392963 (ATF6B)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102392963 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 102392963
NCBI-ProteinID: XP_006059211
LinkDB
Position
2
AA seq 707 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQTELFRCPEQDVPFGSSSL
DLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSNQAPGVGEMLV
VKSESLAPPLCLLGDDPTSPFETIQINVSATSDDPSDVQIKIEPASPSSSINSEAPLLSA
ESPSQAFIGEEVLEVKTESPSPQGCLLRDVPGPPPGAVQISMGLSSDGSSGKALPARKPP
LQPKPMLITTVPMPPRALPASTTVLLQPLVQPPPVSPVVLIQGAVRVQPEGPTPPPPRPE
RKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLTENSELKLGSGNRKVVCVMVFLLFIAFNFGPVSISEPPPAS
ISPRMSRGESRPRRHLLEFSAQEPVHGAEPPQHPFQDPEEPHPSPAGHPSFRNLTAFPGD
TRELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKTPQRAQEKQKSQLR
KKSPPVQAVPTRPPGPPEGDSVGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRDHLL
LPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVIHIKTSTVP
PSLRKQPSSTPGNATGGPLPASAAASQAHQAAHQPSTSIISDLYDSH
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggcggagctgatgcttctcagcgagattgcggacccgacacgctttttcaccgacaac
ttgctgagcccggaggactgggacagcactttgtactccggcttggatgaagtggccgag
gagcagacggagctcttccgttgtccggagcaggatgtcccgtttggcagcagctccctg
gacttggggatggacgtcagccctcctgaacccccctgggactctctgcctatcttccca
gatctccaggtgaagtctgagccatcctccccctgctcttcctcctccctcagctctgaa
tcgtcgcatctttccacagagccctccaaccaggcccctggtgtaggggagatgctggtt
gtgaagtcagagtccttggcacccccactctgcctcctgggagatgatccaacatcccca
tttgaaaccatccagatcaatgtcagcgccacctctgatgatccttcagatgttcagatt
aagatagagcctgcctctccatcttcctccatcaactcggaggctcccctgctctctgcg
gagtcccccagccaggctttcataggagaggaggtcctggaagtgaagacagagtcccca
tcccctcaggggtgtctcctgcgggatgtccccggcccccctcctggagctgtccagatc
agcatgggcctgtcctctgacggctcctcaggcaaagccctgcccgcccggaagccacca
ctgcagcccaagcccatgctgataaccactgtcccgatgcccccaagagccttgcctgcc
agcaccaccgtcctcttgcagccccttgtccagccacccccagtgtccccagttgtcctc
atccaaggtgctgttcgagtccagcctgagggaccgacccctcctcctccacggcctgag
aggaagagcattgttccagcccctatgcctgggaactcctgcccgcctgaggtggatgcc
aagctgctgaagcggcagcagcggatgatcaagaaccgggagtcggcctgccagtcccgc
aggaagaagaaagagtacctgcaggggttggaagcccggctgcaggccgtgctggccgac
aaccagcagctccggagggagaatgctgccctccgccggcggctggaggccctgctgact
gagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcgtcatggtcttc
cttctcttcatcgctttcaactttgggcctgtgagcatcagtgagcctcctccggcttcc
atctctcctcggatgagcagaggggagtctcgaccccggagacacttgctggaattctcg
gcacaagagccagttcatggagccgagcccccccaacatcccttccaggaccctgaggag
ccccatcccagccccgcgggccacccaagtttcaggaacctgacagccttccctggggac
accagggagctgctgctgagagacctggaccagctcttcctctcctcggattgccggcac
ttcaaccgaaccgagtccctgaggcttgccgacgagctgagtggctgggtccagcgccac
cagagaggccggcggaagacaccccagagagcccaggagaaacagaagtctcagctgcgg
aagaagtctcctccagttcaggcagtccccacccgcccccctgggcccccggaaggggat
tctgtgggccagctgcagctgtaccgccaaccagaccgttcgcagcccgagttcctggat
gcaattgaccgacgggaagacacattttacgttgtctccttccgaagggaccacttgctg
ctcccagccatcagccacaacaagacctcccggcccaagatgtccctggtgatgcctgct
atggcccccaatgagaccctgtcaggccgggggccccctggggactatgaggagatgatg
cagatcgagtgtgaggtcatggatacgagggtgattcacatcaagacctccacagtgccc
ccctcgctacgaaaacagccgtcctcaaccccgggcaatgccacaggtggccccttgcca
gcttctgcagcagccagccaggctcaccaggctgcccatcagccctctacctcaatcatc
tctgacctctatgactcacactga

DBGET integrated database retrieval system