Bubalus bubalis (water buffalo): 102392995 Help Entry 102392995         CDS       T05912                                  Gene name KRAS Definition (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01521   EGFR tyrosine kinase inhibitor resistance bbub01522   Endocrine resistance bbub04010   MAPK signaling pathway bbub04012   ErbB signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04062   Chemokine signaling pathway bbub04068   FoxO signaling pathway bbub04071   Sphingolipid signaling pathway bbub04072   Phospholipase D signaling pathway bbub04137   Mitophagy - animal bbub04140   Autophagy - animal bbub04150   mTOR signaling pathway bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04211   Longevity regulating pathway bbub04213   Longevity regulating pathway - multiple species bbub04218   Cellular senescence bbub04360   Axon guidance bbub04370   VEGF signaling pathway bbub04371   Apelin signaling pathway bbub04540   Gap junction bbub04550   Signaling pathways regulating pluripotency of stem cells bbub04625   C-type lectin receptor signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04664   Fc epsilon RI signaling pathway bbub04714   Thermogenesis bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04725   Cholinergic synapse bbub04726   Serotonergic synapse bbub04730   Long-term depression bbub04810   Regulation of actin cytoskeleton bbub04910   Insulin signaling pathway bbub04912   GnRH signaling pathway bbub04914   Progesterone-mediated oocyte maturation bbub04915   Estrogen signaling pathway bbub04916   Melanogenesis bbub04917   Prolactin signaling pathway bbub04919   Thyroid hormone signaling pathway bbub04921   Oxytocin signaling pathway bbub04926   Relaxin signaling pathway bbub04929   GnRH secretion bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04935   Growth hormone synthesis, secretion and action bbub04960   Aldosterone-regulated sodium reabsorption bbub05010   Alzheimer disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05034   Alcoholism bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05163   Human cytomegalovirus infection bbub05165   Human papillomavirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05205   Proteoglycans in cancer bbub05206   MicroRNAs in cancer bbub05210   Colorectal cancer bbub05211   Renal cell carcinoma bbub05212   Pancreatic cancer bbub05213   Endometrial cancer bbub05214   Glioma bbub05215   Prostate cancer bbub05216   Thyroid cancer bbub05218   Melanoma bbub05219   Bladder cancer bbub05220   Chronic myeloid leukemia bbub05221   Acute myeloid leukemia bbub05223   Non-small cell lung cancer bbub05224   Breast cancer bbub05225   Hepatocellular carcinoma bbub05226   Gastric cancer bbub05230   Central carbon metabolism in cancer bbub05231   Choline metabolism in cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102392995 (KRAS)    04012 ErbB signaling pathway     102392995 (KRAS)    04014 Ras signaling pathway     102392995 (KRAS)    04015 Rap1 signaling pathway     102392995 (KRAS)    04370 VEGF signaling pathway     102392995 (KRAS)    04371 Apelin signaling pathway     102392995 (KRAS)    04068 FoxO signaling pathway     102392995 (KRAS)    04072 Phospholipase D signaling pathway     102392995 (KRAS)    04071 Sphingolipid signaling pathway     102392995 (KRAS)    04151 PI3K-Akt signaling pathway     102392995 (KRAS)    04150 mTOR signaling pathway     102392995 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102392995 (KRAS)    04137 Mitophagy - animal     102392995 (KRAS)   09143 Cell growth and death    04210 Apoptosis     102392995 (KRAS)    04218 Cellular senescence     102392995 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102392995 (KRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102392995 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102392995 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102392995 (KRAS)    04650 Natural killer cell mediated cytotoxicity     102392995 (KRAS)    04660 T cell receptor signaling pathway     102392995 (KRAS)    04662 B cell receptor signaling pathway     102392995 (KRAS)    04664 Fc epsilon RI signaling pathway     102392995 (KRAS)    04062 Chemokine signaling pathway     102392995 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102392995 (KRAS)    04929 GnRH secretion     102392995 (KRAS)    04912 GnRH signaling pathway     102392995 (KRAS)    04915 Estrogen signaling pathway     102392995 (KRAS)    04914 Progesterone-mediated oocyte maturation     102392995 (KRAS)    04917 Prolactin signaling pathway     102392995 (KRAS)    04921 Oxytocin signaling pathway     102392995 (KRAS)    04926 Relaxin signaling pathway     102392995 (KRAS)    04935 Growth hormone synthesis, secretion and action     102392995 (KRAS)    04919 Thyroid hormone signaling pathway     102392995 (KRAS)    04916 Melanogenesis     102392995 (KRAS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102392995 (KRAS)   09156 Nervous system    04725 Cholinergic synapse     102392995 (KRAS)    04726 Serotonergic synapse     102392995 (KRAS)    04720 Long-term potentiation     102392995 (KRAS)    04730 Long-term depression     102392995 (KRAS)    04722 Neurotrophin signaling pathway     102392995 (KRAS)   09158 Development and regeneration    04360 Axon guidance     102392995 (KRAS)   09149 Aging    04211 Longevity regulating pathway     102392995 (KRAS)    04213 Longevity regulating pathway - multiple species     102392995 (KRAS)   09159 Environmental adaptation    04714 Thermogenesis     102392995 (KRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102392995 (KRAS)    05206 MicroRNAs in cancer     102392995 (KRAS)    05205 Proteoglycans in cancer     102392995 (KRAS)    05203 Viral carcinogenesis     102392995 (KRAS)    05230 Central carbon metabolism in cancer     102392995 (KRAS)    05231 Choline metabolism in cancer     102392995 (KRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102392995 (KRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102392995 (KRAS)    05212 Pancreatic cancer     102392995 (KRAS)    05225 Hepatocellular carcinoma     102392995 (KRAS)    05226 Gastric cancer     102392995 (KRAS)    05214 Glioma     102392995 (KRAS)    05216 Thyroid cancer     102392995 (KRAS)    05221 Acute myeloid leukemia     102392995 (KRAS)    05220 Chronic myeloid leukemia     102392995 (KRAS)    05218 Melanoma     102392995 (KRAS)    05211 Renal cell carcinoma     102392995 (KRAS)    05219 Bladder cancer     102392995 (KRAS)    05215 Prostate cancer     102392995 (KRAS)    05213 Endometrial cancer     102392995 (KRAS)    05224 Breast cancer     102392995 (KRAS)    05223 Non-small cell lung cancer     102392995 (KRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102392995 (KRAS)    05022 Pathways of neurodegeneration - multiple diseases     102392995 (KRAS)   09165 Substance dependence    05034 Alcoholism     102392995 (KRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102392995 (KRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102392995 (KRAS)    05170 Human immunodeficiency virus 1 infection     102392995 (KRAS)    05161 Hepatitis B     102392995 (KRAS)    05160 Hepatitis C     102392995 (KRAS)    05163 Human cytomegalovirus infection     102392995 (KRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102392995 (KRAS)    05165 Human papillomavirus infection     102392995 (KRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102392995 (KRAS)    01522 Endocrine resistance     102392995 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102392995 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bbub04031]     102392995 (KRAS) Membrane trafficking [BR:bbub04131]  Endocytosis   Macropinocytosis    Ras GTPases     102392995 (KRAS) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102392995 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin AAA_25 CbiA Motif Other DBs NCBI-GeneID:  102392995 NCBI-ProteinID:  XP_025139184 LinkDB All DBs Position 4 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt gtgtttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt gtgaaaattaaaaaatgcattgtaatgtaa

Bubalus bubalis (water buffalo): 102393319 Help Entry 102393319         CDS       T05912                                  Gene name HRAS Definition (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01521   EGFR tyrosine kinase inhibitor resistance bbub01522   Endocrine resistance bbub04010   MAPK signaling pathway bbub04012   ErbB signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04062   Chemokine signaling pathway bbub04068   FoxO signaling pathway bbub04071   Sphingolipid signaling pathway bbub04072   Phospholipase D signaling pathway bbub04137   Mitophagy - animal bbub04140   Autophagy - animal bbub04144   Endocytosis bbub04150   mTOR signaling pathway bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04211   Longevity regulating pathway bbub04213   Longevity regulating pathway - multiple species bbub04218   Cellular senescence bbub04360   Axon guidance bbub04370   VEGF signaling pathway bbub04371   Apelin signaling pathway bbub04510   Focal adhesion bbub04540   Gap junction bbub04550   Signaling pathways regulating pluripotency of stem cells bbub04625   C-type lectin receptor signaling pathway bbub04630   JAK-STAT signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04664   Fc epsilon RI signaling pathway bbub04714   Thermogenesis bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04725   Cholinergic synapse bbub04726   Serotonergic synapse bbub04730   Long-term depression bbub04810   Regulation of actin cytoskeleton bbub04910   Insulin signaling pathway bbub04912   GnRH signaling pathway bbub04915   Estrogen signaling pathway bbub04916   Melanogenesis bbub04917   Prolactin signaling pathway bbub04919   Thyroid hormone signaling pathway bbub04921   Oxytocin signaling pathway bbub04926   Relaxin signaling pathway bbub04929   GnRH secretion bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04935   Growth hormone synthesis, secretion and action bbub05010   Alzheimer disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05034   Alcoholism bbub05132   Salmonella infection bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05163   Human cytomegalovirus infection bbub05165   Human papillomavirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05205   Proteoglycans in cancer bbub05206   MicroRNAs in cancer bbub05210   Colorectal cancer bbub05211   Renal cell carcinoma bbub05213   Endometrial cancer bbub05214   Glioma bbub05215   Prostate cancer bbub05216   Thyroid cancer bbub05218   Melanoma bbub05219   Bladder cancer bbub05220   Chronic myeloid leukemia bbub05221   Acute myeloid leukemia bbub05223   Non-small cell lung cancer bbub05224   Breast cancer bbub05225   Hepatocellular carcinoma bbub05226   Gastric cancer bbub05230   Central carbon metabolism in cancer bbub05231   Choline metabolism in cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102393319 (HRAS)    04012 ErbB signaling pathway     102393319 (HRAS)    04014 Ras signaling pathway     102393319 (HRAS)    04015 Rap1 signaling pathway     102393319 (HRAS)    04370 VEGF signaling pathway     102393319 (HRAS)    04371 Apelin signaling pathway     102393319 (HRAS)    04630 JAK-STAT signaling pathway     102393319 (HRAS)    04068 FoxO signaling pathway     102393319 (HRAS)    04072 Phospholipase D signaling pathway     102393319 (HRAS)    04071 Sphingolipid signaling pathway     102393319 (HRAS)    04151 PI3K-Akt signaling pathway     102393319 (HRAS)    04150 mTOR signaling pathway     102393319 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102393319 (HRAS)    04140 Autophagy - animal     102393319 (HRAS)    04137 Mitophagy - animal     102393319 (HRAS)   09143 Cell growth and death    04210 Apoptosis     102393319 (HRAS)    04218 Cellular senescence     102393319 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102393319 (HRAS)    04540 Gap junction     102393319 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102393319 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102393319 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102393319 (HRAS)    04650 Natural killer cell mediated cytotoxicity     102393319 (HRAS)    04660 T cell receptor signaling pathway     102393319 (HRAS)    04662 B cell receptor signaling pathway     102393319 (HRAS)    04664 Fc epsilon RI signaling pathway     102393319 (HRAS)    04062 Chemokine signaling pathway     102393319 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102393319 (HRAS)    04929 GnRH secretion     102393319 (HRAS)    04912 GnRH signaling pathway     102393319 (HRAS)    04915 Estrogen signaling pathway     102393319 (HRAS)    04917 Prolactin signaling pathway     102393319 (HRAS)    04921 Oxytocin signaling pathway     102393319 (HRAS)    04926 Relaxin signaling pathway     102393319 (HRAS)    04935 Growth hormone synthesis, secretion and action     102393319 (HRAS)    04919 Thyroid hormone signaling pathway     102393319 (HRAS)    04916 Melanogenesis     102393319 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     102393319 (HRAS)    04726 Serotonergic synapse     102393319 (HRAS)    04720 Long-term potentiation     102393319 (HRAS)    04730 Long-term depression     102393319 (HRAS)    04722 Neurotrophin signaling pathway     102393319 (HRAS)   09158 Development and regeneration    04360 Axon guidance     102393319 (HRAS)   09149 Aging    04211 Longevity regulating pathway     102393319 (HRAS)    04213 Longevity regulating pathway - multiple species     102393319 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     102393319 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102393319 (HRAS)    05206 MicroRNAs in cancer     102393319 (HRAS)    05205 Proteoglycans in cancer     102393319 (HRAS)    05203 Viral carcinogenesis     102393319 (HRAS)    05230 Central carbon metabolism in cancer     102393319 (HRAS)    05231 Choline metabolism in cancer     102393319 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102393319 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102393319 (HRAS)    05225 Hepatocellular carcinoma     102393319 (HRAS)    05226 Gastric cancer     102393319 (HRAS)    05214 Glioma     102393319 (HRAS)    05216 Thyroid cancer     102393319 (HRAS)    05221 Acute myeloid leukemia     102393319 (HRAS)    05220 Chronic myeloid leukemia     102393319 (HRAS)    05218 Melanoma     102393319 (HRAS)    05211 Renal cell carcinoma     102393319 (HRAS)    05219 Bladder cancer     102393319 (HRAS)    05215 Prostate cancer     102393319 (HRAS)    05213 Endometrial cancer     102393319 (HRAS)    05224 Breast cancer     102393319 (HRAS)    05223 Non-small cell lung cancer     102393319 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102393319 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     102393319 (HRAS)   09165 Substance dependence    05034 Alcoholism     102393319 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102393319 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102393319 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102393319 (HRAS)    05170 Human immunodeficiency virus 1 infection     102393319 (HRAS)    05161 Hepatitis B     102393319 (HRAS)    05160 Hepatitis C     102393319 (HRAS)    05163 Human cytomegalovirus infection     102393319 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102393319 (HRAS)    05165 Human papillomavirus infection     102393319 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102393319 (HRAS)    01522 Endocrine resistance     102393319 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102393319 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102393319 (HRAS)    04031 GTP-binding proteins [BR:bbub04031]     102393319 (HRAS) Membrane trafficking [BR:bbub04131]  Endocytosis   Macropinocytosis    Ras GTPases     102393319 (HRAS) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102393319 (HRAS)   Exosomal proteins of colorectal cancer cells    102393319 (HRAS) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102393319 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N G-alpha Septin Ldh_1_N AAA_25 Motif Other DBs NCBI-GeneID:  102393319 NCBI-ProteinID:  XP_006045817 LinkDB All DBs Position 5 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINHVKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKVRKLSPPDEGGPG CLSCRCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgccggtggcgtggggaagagcgccctgact atccagctcattcagaatcacttcgtggacgagtacgatcccaccatcgaggattcctac cggaagcaagtggtcatcgatggggagacgtgcctgctggacatcctggacacggcgggc caggaggagtacagtgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc gtgtttgccatcaaccacgtcaagtccttcgaggacatccatcagtaccgggagcagatc aagcgagtgaaggactcggatgacgtgcccatggtgttggtcgggaacaagtgcgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccg tacatcgagacctccgccaagacccgccagggcgtggaggatgctttctacaccctggtg cgcgagatccggcagcacaaggtgcgcaagctgagcccgccggacgagggcggccccggc tgcctgagctgcaggtgcctgctctcctga

Bubalus bubalis (water buffalo): 102399487 Help Entry 102399487         CDS       T05912                                  Gene name NRAS Definition (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01521   EGFR tyrosine kinase inhibitor resistance bbub01522   Endocrine resistance bbub04010   MAPK signaling pathway bbub04012   ErbB signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04062   Chemokine signaling pathway bbub04068   FoxO signaling pathway bbub04071   Sphingolipid signaling pathway bbub04072   Phospholipase D signaling pathway bbub04137   Mitophagy - animal bbub04140   Autophagy - animal bbub04150   mTOR signaling pathway bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04211   Longevity regulating pathway bbub04213   Longevity regulating pathway - multiple species bbub04218   Cellular senescence bbub04360   Axon guidance bbub04370   VEGF signaling pathway bbub04371   Apelin signaling pathway bbub04540   Gap junction bbub04550   Signaling pathways regulating pluripotency of stem cells bbub04625   C-type lectin receptor signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04664   Fc epsilon RI signaling pathway bbub04714   Thermogenesis bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04725   Cholinergic synapse bbub04726   Serotonergic synapse bbub04730   Long-term depression bbub04810   Regulation of actin cytoskeleton bbub04910   Insulin signaling pathway bbub04912   GnRH signaling pathway bbub04915   Estrogen signaling pathway bbub04916   Melanogenesis bbub04917   Prolactin signaling pathway bbub04919   Thyroid hormone signaling pathway bbub04921   Oxytocin signaling pathway bbub04926   Relaxin signaling pathway bbub04929   GnRH secretion bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04935   Growth hormone synthesis, secretion and action bbub05010   Alzheimer disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05034   Alcoholism bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05163   Human cytomegalovirus infection bbub05165   Human papillomavirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05205   Proteoglycans in cancer bbub05206   MicroRNAs in cancer bbub05210   Colorectal cancer bbub05211   Renal cell carcinoma bbub05213   Endometrial cancer bbub05214   Glioma bbub05215   Prostate cancer bbub05216   Thyroid cancer bbub05218   Melanoma bbub05219   Bladder cancer bbub05220   Chronic myeloid leukemia bbub05221   Acute myeloid leukemia bbub05223   Non-small cell lung cancer bbub05224   Breast cancer bbub05225   Hepatocellular carcinoma bbub05226   Gastric cancer bbub05230   Central carbon metabolism in cancer bbub05231   Choline metabolism in cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102399487 (NRAS)    04012 ErbB signaling pathway     102399487 (NRAS)    04014 Ras signaling pathway     102399487 (NRAS)    04015 Rap1 signaling pathway     102399487 (NRAS)    04370 VEGF signaling pathway     102399487 (NRAS)    04371 Apelin signaling pathway     102399487 (NRAS)    04068 FoxO signaling pathway     102399487 (NRAS)    04072 Phospholipase D signaling pathway     102399487 (NRAS)    04071 Sphingolipid signaling pathway     102399487 (NRAS)    04151 PI3K-Akt signaling pathway     102399487 (NRAS)    04150 mTOR signaling pathway     102399487 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102399487 (NRAS)    04137 Mitophagy - animal     102399487 (NRAS)   09143 Cell growth and death    04210 Apoptosis     102399487 (NRAS)    04218 Cellular senescence     102399487 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102399487 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102399487 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102399487 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102399487 (NRAS)    04650 Natural killer cell mediated cytotoxicity     102399487 (NRAS)    04660 T cell receptor signaling pathway     102399487 (NRAS)    04662 B cell receptor signaling pathway     102399487 (NRAS)    04664 Fc epsilon RI signaling pathway     102399487 (NRAS)    04062 Chemokine signaling pathway     102399487 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102399487 (NRAS)    04929 GnRH secretion     102399487 (NRAS)    04912 GnRH signaling pathway     102399487 (NRAS)    04915 Estrogen signaling pathway     102399487 (NRAS)    04917 Prolactin signaling pathway     102399487 (NRAS)    04921 Oxytocin signaling pathway     102399487 (NRAS)    04926 Relaxin signaling pathway     102399487 (NRAS)    04935 Growth hormone synthesis, secretion and action     102399487 (NRAS)    04919 Thyroid hormone signaling pathway     102399487 (NRAS)    04916 Melanogenesis     102399487 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     102399487 (NRAS)    04726 Serotonergic synapse     102399487 (NRAS)    04720 Long-term potentiation     102399487 (NRAS)    04730 Long-term depression     102399487 (NRAS)    04722 Neurotrophin signaling pathway     102399487 (NRAS)   09158 Development and regeneration    04360 Axon guidance     102399487 (NRAS)   09149 Aging    04211 Longevity regulating pathway     102399487 (NRAS)    04213 Longevity regulating pathway - multiple species     102399487 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     102399487 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102399487 (NRAS)    05206 MicroRNAs in cancer     102399487 (NRAS)    05205 Proteoglycans in cancer     102399487 (NRAS)    05203 Viral carcinogenesis     102399487 (NRAS)    05230 Central carbon metabolism in cancer     102399487 (NRAS)    05231 Choline metabolism in cancer     102399487 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102399487 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102399487 (NRAS)    05225 Hepatocellular carcinoma     102399487 (NRAS)    05226 Gastric cancer     102399487 (NRAS)    05214 Glioma     102399487 (NRAS)    05216 Thyroid cancer     102399487 (NRAS)    05221 Acute myeloid leukemia     102399487 (NRAS)    05220 Chronic myeloid leukemia     102399487 (NRAS)    05218 Melanoma     102399487 (NRAS)    05211 Renal cell carcinoma     102399487 (NRAS)    05219 Bladder cancer     102399487 (NRAS)    05215 Prostate cancer     102399487 (NRAS)    05213 Endometrial cancer     102399487 (NRAS)    05224 Breast cancer     102399487 (NRAS)    05223 Non-small cell lung cancer     102399487 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102399487 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     102399487 (NRAS)   09165 Substance dependence    05034 Alcoholism     102399487 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102399487 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102399487 (NRAS)    05170 Human immunodeficiency virus 1 infection     102399487 (NRAS)    05161 Hepatitis B     102399487 (NRAS)    05160 Hepatitis C     102399487 (NRAS)    05163 Human cytomegalovirus infection     102399487 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102399487 (NRAS)    05165 Human papillomavirus infection     102399487 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102399487 (NRAS)    01522 Endocrine resistance     102399487 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102399487 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102399487 (NRAS)    04031 GTP-binding proteins [BR:bbub04031]     102399487 (NRAS) Membrane trafficking [BR:bbub04131]  Endocytosis   Macropinocytosis    Ras GTPases     102399487 (NRAS) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102399487 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    102399487 (NRAS)   Exosomal proteins of breast cancer cells    102399487 (NRAS)   Exosomal proteins of colorectal cancer cells    102399487 (NRAS) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102399487 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  102399487 NCBI-ProteinID:  XP_006064867 LinkDB All DBs Position 6 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVV NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggctaaaagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagacgccttttacacactggta agagaaatacgccagtaccggatgaaaaagctcaacagcagtgatgatggcactcaaggc tgtatggggctgccatgtgtggtggtgtaa

Bubalus bubalis (water buffalo): 112587129 Help Entry 112587129         CDS       T05912                                  Definition (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01521   EGFR tyrosine kinase inhibitor resistance bbub01522   Endocrine resistance bbub04010   MAPK signaling pathway bbub04012   ErbB signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04062   Chemokine signaling pathway bbub04068   FoxO signaling pathway bbub04071   Sphingolipid signaling pathway bbub04072   Phospholipase D signaling pathway bbub04137   Mitophagy - animal bbub04140   Autophagy - animal bbub04144   Endocytosis bbub04150   mTOR signaling pathway bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04211   Longevity regulating pathway bbub04213   Longevity regulating pathway - multiple species bbub04218   Cellular senescence bbub04360   Axon guidance bbub04370   VEGF signaling pathway bbub04371   Apelin signaling pathway bbub04510   Focal adhesion bbub04540   Gap junction bbub04550   Signaling pathways regulating pluripotency of stem cells bbub04625   C-type lectin receptor signaling pathway bbub04630   JAK-STAT signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04664   Fc epsilon RI signaling pathway bbub04714   Thermogenesis bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04725   Cholinergic synapse bbub04726   Serotonergic synapse bbub04730   Long-term depression bbub04810   Regulation of actin cytoskeleton bbub04910   Insulin signaling pathway bbub04912   GnRH signaling pathway bbub04915   Estrogen signaling pathway bbub04916   Melanogenesis bbub04917   Prolactin signaling pathway bbub04919   Thyroid hormone signaling pathway bbub04921   Oxytocin signaling pathway bbub04926   Relaxin signaling pathway bbub04929   GnRH secretion bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04935   Growth hormone synthesis, secretion and action bbub05010   Alzheimer disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05034   Alcoholism bbub05132   Salmonella infection bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05163   Human cytomegalovirus infection bbub05165   Human papillomavirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05205   Proteoglycans in cancer bbub05206   MicroRNAs in cancer bbub05210   Colorectal cancer bbub05211   Renal cell carcinoma bbub05213   Endometrial cancer bbub05214   Glioma bbub05215   Prostate cancer bbub05216   Thyroid cancer bbub05218   Melanoma bbub05219   Bladder cancer bbub05220   Chronic myeloid leukemia bbub05221   Acute myeloid leukemia bbub05223   Non-small cell lung cancer bbub05224   Breast cancer bbub05225   Hepatocellular carcinoma bbub05226   Gastric cancer bbub05230   Central carbon metabolism in cancer bbub05231   Choline metabolism in cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112587129    04012 ErbB signaling pathway     112587129    04014 Ras signaling pathway     112587129    04015 Rap1 signaling pathway     112587129    04370 VEGF signaling pathway     112587129    04371 Apelin signaling pathway     112587129    04630 JAK-STAT signaling pathway     112587129    04068 FoxO signaling pathway     112587129    04072 Phospholipase D signaling pathway     112587129    04071 Sphingolipid signaling pathway     112587129    04151 PI3K-Akt signaling pathway     112587129    04150 mTOR signaling pathway     112587129  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112587129    04140 Autophagy - animal     112587129    04137 Mitophagy - animal     112587129   09143 Cell growth and death    04210 Apoptosis     112587129    04218 Cellular senescence     112587129   09144 Cellular community - eukaryotes    04510 Focal adhesion     112587129    04540 Gap junction     112587129    04550 Signaling pathways regulating pluripotency of stem cells     112587129   09142 Cell motility    04810 Regulation of actin cytoskeleton     112587129  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112587129    04650 Natural killer cell mediated cytotoxicity     112587129    04660 T cell receptor signaling pathway     112587129    04662 B cell receptor signaling pathway     112587129    04664 Fc epsilon RI signaling pathway     112587129    04062 Chemokine signaling pathway     112587129   09152 Endocrine system    04910 Insulin signaling pathway     112587129    04929 GnRH secretion     112587129    04912 GnRH signaling pathway     112587129    04915 Estrogen signaling pathway     112587129    04917 Prolactin signaling pathway     112587129    04921 Oxytocin signaling pathway     112587129    04926 Relaxin signaling pathway     112587129    04935 Growth hormone synthesis, secretion and action     112587129    04919 Thyroid hormone signaling pathway     112587129    04916 Melanogenesis     112587129   09156 Nervous system    04725 Cholinergic synapse     112587129    04726 Serotonergic synapse     112587129    04720 Long-term potentiation     112587129    04730 Long-term depression     112587129    04722 Neurotrophin signaling pathway     112587129   09158 Development and regeneration    04360 Axon guidance     112587129   09149 Aging    04211 Longevity regulating pathway     112587129    04213 Longevity regulating pathway - multiple species     112587129   09159 Environmental adaptation    04714 Thermogenesis     112587129  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112587129    05206 MicroRNAs in cancer     112587129    05205 Proteoglycans in cancer     112587129    05203 Viral carcinogenesis     112587129    05230 Central carbon metabolism in cancer     112587129    05231 Choline metabolism in cancer     112587129    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112587129   09162 Cancer: specific types    05210 Colorectal cancer     112587129    05225 Hepatocellular carcinoma     112587129    05226 Gastric cancer     112587129    05214 Glioma     112587129    05216 Thyroid cancer     112587129    05221 Acute myeloid leukemia     112587129    05220 Chronic myeloid leukemia     112587129    05218 Melanoma     112587129    05211 Renal cell carcinoma     112587129    05219 Bladder cancer     112587129    05215 Prostate cancer     112587129    05213 Endometrial cancer     112587129    05224 Breast cancer     112587129    05223 Non-small cell lung cancer     112587129   09164 Neurodegenerative disease    05010 Alzheimer disease     112587129    05022 Pathways of neurodegeneration - multiple diseases     112587129   09165 Substance dependence    05034 Alcoholism     112587129   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112587129   09171 Infectious disease: bacterial    05132 Salmonella infection     112587129   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112587129    05170 Human immunodeficiency virus 1 infection     112587129    05161 Hepatitis B     112587129    05160 Hepatitis C     112587129    05163 Human cytomegalovirus infection     112587129    05167 Kaposi sarcoma-associated herpesvirus infection     112587129    05165 Human papillomavirus infection     112587129   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112587129    01522 Endocrine resistance     112587129  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     112587129   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     112587129    04031 GTP-binding proteins [BR:bbub04031]     112587129 Membrane trafficking [BR:bbub04131]  Endocytosis   Macropinocytosis    Ras GTPases     112587129 Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    112587129   Exosomal proteins of colorectal cancer cells    112587129 GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112587129 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  112587129 NCBI-ProteinID:  XP_025149985 LinkDB All DBs Position 9 AA seq 109 aa AA seqDB search MRKSALTIQLIKNHPMEDNSTMEEGWLSLSSYWKQVVTNGETYLLDTAGQESQHHGDQYM STREGFPLGVCINNTESFKGIHQPWEQIKWVKDSDGIPVVLVGTSVTWS NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgaggaagagtgccctgaccatccagctcattaagaaccaccccatggaggacaactcc accatggaggaaggttggctgtctctaagttcctactggaagcaagtggtcaccaatggg gagacctacctactggacacagcaggccaggagagtcagcatcatggagaccagtacatg agcaccagggagggctttcctctgggtgtttgcatcaacaataccgagtccttcaagggc atccaccagccctgggagcagatcaagtgggtgaaggactcagatggcatacctgtggtg ctagtgggaacgagtgtgacctggtcatag

DBGET integrated database retrieval system