KEGG   Bubalus bubalis (water buffalo): 102392995
Entry
102392995         CDS       T05912                                 

Gene name
KRAS
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04137  Mitophagy - animal
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04540  Gap junction
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04625  C-type lectin receptor signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04714  Thermogenesis
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04960  Aldosterone-regulated sodium reabsorption
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102392995 (KRAS)
   04012 ErbB signaling pathway
    102392995 (KRAS)
   04014 Ras signaling pathway
    102392995 (KRAS)
   04015 Rap1 signaling pathway
    102392995 (KRAS)
   04370 VEGF signaling pathway
    102392995 (KRAS)
   04371 Apelin signaling pathway
    102392995 (KRAS)
   04068 FoxO signaling pathway
    102392995 (KRAS)
   04072 Phospholipase D signaling pathway
    102392995 (KRAS)
   04071 Sphingolipid signaling pathway
    102392995 (KRAS)
   04151 PI3K-Akt signaling pathway
    102392995 (KRAS)
   04150 mTOR signaling pathway
    102392995 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102392995 (KRAS)
   04137 Mitophagy - animal
    102392995 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102392995 (KRAS)
   04218 Cellular senescence
    102392995 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102392995 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102392995 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102392995 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102392995 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    102392995 (KRAS)
   04660 T cell receptor signaling pathway
    102392995 (KRAS)
   04662 B cell receptor signaling pathway
    102392995 (KRAS)
   04664 Fc epsilon RI signaling pathway
    102392995 (KRAS)
   04062 Chemokine signaling pathway
    102392995 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102392995 (KRAS)
   04929 GnRH secretion
    102392995 (KRAS)
   04912 GnRH signaling pathway
    102392995 (KRAS)
   04915 Estrogen signaling pathway
    102392995 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    102392995 (KRAS)
   04917 Prolactin signaling pathway
    102392995 (KRAS)
   04921 Oxytocin signaling pathway
    102392995 (KRAS)
   04926 Relaxin signaling pathway
    102392995 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    102392995 (KRAS)
   04919 Thyroid hormone signaling pathway
    102392995 (KRAS)
   04916 Melanogenesis
    102392995 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102392995 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102392995 (KRAS)
   04726 Serotonergic synapse
    102392995 (KRAS)
   04720 Long-term potentiation
    102392995 (KRAS)
   04730 Long-term depression
    102392995 (KRAS)
   04722 Neurotrophin signaling pathway
    102392995 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102392995 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102392995 (KRAS)
   04213 Longevity regulating pathway - multiple species
    102392995 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102392995 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102392995 (KRAS)
   05206 MicroRNAs in cancer
    102392995 (KRAS)
   05205 Proteoglycans in cancer
    102392995 (KRAS)
   05203 Viral carcinogenesis
    102392995 (KRAS)
   05230 Central carbon metabolism in cancer
    102392995 (KRAS)
   05231 Choline metabolism in cancer
    102392995 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102392995 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102392995 (KRAS)
   05212 Pancreatic cancer
    102392995 (KRAS)
   05225 Hepatocellular carcinoma
    102392995 (KRAS)
   05226 Gastric cancer
    102392995 (KRAS)
   05214 Glioma
    102392995 (KRAS)
   05216 Thyroid cancer
    102392995 (KRAS)
   05221 Acute myeloid leukemia
    102392995 (KRAS)
   05220 Chronic myeloid leukemia
    102392995 (KRAS)
   05218 Melanoma
    102392995 (KRAS)
   05211 Renal cell carcinoma
    102392995 (KRAS)
   05219 Bladder cancer
    102392995 (KRAS)
   05215 Prostate cancer
    102392995 (KRAS)
   05213 Endometrial cancer
    102392995 (KRAS)
   05224 Breast cancer
    102392995 (KRAS)
   05223 Non-small cell lung cancer
    102392995 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102392995 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102392995 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    102392995 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102392995 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102392995 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    102392995 (KRAS)
   05161 Hepatitis B
    102392995 (KRAS)
   05160 Hepatitis C
    102392995 (KRAS)
   05163 Human cytomegalovirus infection
    102392995 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102392995 (KRAS)
   05165 Human papillomavirus infection
    102392995 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102392995 (KRAS)
   01522 Endocrine resistance
    102392995 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102392995 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bbub04031]
    102392995 (KRAS)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102392995 (KRAS)
GTP-binding proteins [BR:bbub04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102392995 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin AAA_25 CbiA
Other DBs
NCBI-GeneID: 102392995
NCBI-ProteinID: XP_025139184
LinkDB
Position
4
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtgtttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

KEGG   Bubalus bubalis (water buffalo): 102393319
Entry
102393319         CDS       T05912                                 

Gene name
HRAS
Definition
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04137  Mitophagy - animal
bbub04140  Autophagy - animal
bbub04144  Endocytosis
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04510  Focal adhesion
bbub04540  Gap junction
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04714  Thermogenesis
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05132  Salmonella infection
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102393319 (HRAS)
   04012 ErbB signaling pathway
    102393319 (HRAS)
   04014 Ras signaling pathway
    102393319 (HRAS)
   04015 Rap1 signaling pathway
    102393319 (HRAS)
   04370 VEGF signaling pathway
    102393319 (HRAS)
   04371 Apelin signaling pathway
    102393319 (HRAS)
   04630 JAK-STAT signaling pathway
    102393319 (HRAS)
   04068 FoxO signaling pathway
    102393319 (HRAS)
   04072 Phospholipase D signaling pathway
    102393319 (HRAS)
   04071 Sphingolipid signaling pathway
    102393319 (HRAS)
   04151 PI3K-Akt signaling pathway
    102393319 (HRAS)
   04150 mTOR signaling pathway
    102393319 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102393319 (HRAS)
   04140 Autophagy - animal
    102393319 (HRAS)
   04137 Mitophagy - animal
    102393319 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102393319 (HRAS)
   04218 Cellular senescence
    102393319 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102393319 (HRAS)
   04540 Gap junction
    102393319 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102393319 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102393319 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102393319 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    102393319 (HRAS)
   04660 T cell receptor signaling pathway
    102393319 (HRAS)
   04662 B cell receptor signaling pathway
    102393319 (HRAS)
   04664 Fc epsilon RI signaling pathway
    102393319 (HRAS)
   04062 Chemokine signaling pathway
    102393319 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102393319 (HRAS)
   04929 GnRH secretion
    102393319 (HRAS)
   04912 GnRH signaling pathway
    102393319 (HRAS)
   04915 Estrogen signaling pathway
    102393319 (HRAS)
   04917 Prolactin signaling pathway
    102393319 (HRAS)
   04921 Oxytocin signaling pathway
    102393319 (HRAS)
   04926 Relaxin signaling pathway
    102393319 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    102393319 (HRAS)
   04919 Thyroid hormone signaling pathway
    102393319 (HRAS)
   04916 Melanogenesis
    102393319 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102393319 (HRAS)
   04726 Serotonergic synapse
    102393319 (HRAS)
   04720 Long-term potentiation
    102393319 (HRAS)
   04730 Long-term depression
    102393319 (HRAS)
   04722 Neurotrophin signaling pathway
    102393319 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102393319 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102393319 (HRAS)
   04213 Longevity regulating pathway - multiple species
    102393319 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102393319 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102393319 (HRAS)
   05206 MicroRNAs in cancer
    102393319 (HRAS)
   05205 Proteoglycans in cancer
    102393319 (HRAS)
   05203 Viral carcinogenesis
    102393319 (HRAS)
   05230 Central carbon metabolism in cancer
    102393319 (HRAS)
   05231 Choline metabolism in cancer
    102393319 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102393319 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102393319 (HRAS)
   05225 Hepatocellular carcinoma
    102393319 (HRAS)
   05226 Gastric cancer
    102393319 (HRAS)
   05214 Glioma
    102393319 (HRAS)
   05216 Thyroid cancer
    102393319 (HRAS)
   05221 Acute myeloid leukemia
    102393319 (HRAS)
   05220 Chronic myeloid leukemia
    102393319 (HRAS)
   05218 Melanoma
    102393319 (HRAS)
   05211 Renal cell carcinoma
    102393319 (HRAS)
   05219 Bladder cancer
    102393319 (HRAS)
   05215 Prostate cancer
    102393319 (HRAS)
   05213 Endometrial cancer
    102393319 (HRAS)
   05224 Breast cancer
    102393319 (HRAS)
   05223 Non-small cell lung cancer
    102393319 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102393319 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102393319 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    102393319 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102393319 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102393319 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102393319 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    102393319 (HRAS)
   05161 Hepatitis B
    102393319 (HRAS)
   05160 Hepatitis C
    102393319 (HRAS)
   05163 Human cytomegalovirus infection
    102393319 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102393319 (HRAS)
   05165 Human papillomavirus infection
    102393319 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102393319 (HRAS)
   01522 Endocrine resistance
    102393319 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102393319 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102393319 (HRAS)
   04031 GTP-binding proteins [BR:bbub04031]
    102393319 (HRAS)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102393319 (HRAS)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102393319 (HRAS)
  Exosomal proteins of colorectal cancer cells
   102393319 (HRAS)
GTP-binding proteins [BR:bbub04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102393319 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N G-alpha Septin Ldh_1_N AAA_25
Other DBs
NCBI-GeneID: 102393319
NCBI-ProteinID: XP_006045817
LinkDB
Position
5
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINHVKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKVRKLSPPDEGGPG
CLSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgccggtggcgtggggaagagcgccctgact
atccagctcattcagaatcacttcgtggacgagtacgatcccaccatcgaggattcctac
cggaagcaagtggtcatcgatggggagacgtgcctgctggacatcctggacacggcgggc
caggaggagtacagtgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc
gtgtttgccatcaaccacgtcaagtccttcgaggacatccatcagtaccgggagcagatc
aagcgagtgaaggactcggatgacgtgcccatggtgttggtcgggaacaagtgcgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccg
tacatcgagacctccgccaagacccgccagggcgtggaggatgctttctacaccctggtg
cgcgagatccggcagcacaaggtgcgcaagctgagcccgccggacgagggcggccccggc
tgcctgagctgcaggtgcctgctctcctga

KEGG   Bubalus bubalis (water buffalo): 102399487
Entry
102399487         CDS       T05912                                 

Gene name
NRAS
Definition
(RefSeq) GTPase NRas isoform X1
  KO
K07828  GTPase NRas
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04137  Mitophagy - animal
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04540  Gap junction
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04625  C-type lectin receptor signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04714  Thermogenesis
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102399487 (NRAS)
   04012 ErbB signaling pathway
    102399487 (NRAS)
   04014 Ras signaling pathway
    102399487 (NRAS)
   04015 Rap1 signaling pathway
    102399487 (NRAS)
   04370 VEGF signaling pathway
    102399487 (NRAS)
   04371 Apelin signaling pathway
    102399487 (NRAS)
   04068 FoxO signaling pathway
    102399487 (NRAS)
   04072 Phospholipase D signaling pathway
    102399487 (NRAS)
   04071 Sphingolipid signaling pathway
    102399487 (NRAS)
   04151 PI3K-Akt signaling pathway
    102399487 (NRAS)
   04150 mTOR signaling pathway
    102399487 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102399487 (NRAS)
   04137 Mitophagy - animal
    102399487 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102399487 (NRAS)
   04218 Cellular senescence
    102399487 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102399487 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102399487 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102399487 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102399487 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    102399487 (NRAS)
   04660 T cell receptor signaling pathway
    102399487 (NRAS)
   04662 B cell receptor signaling pathway
    102399487 (NRAS)
   04664 Fc epsilon RI signaling pathway
    102399487 (NRAS)
   04062 Chemokine signaling pathway
    102399487 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102399487 (NRAS)
   04929 GnRH secretion
    102399487 (NRAS)
   04912 GnRH signaling pathway
    102399487 (NRAS)
   04915 Estrogen signaling pathway
    102399487 (NRAS)
   04917 Prolactin signaling pathway
    102399487 (NRAS)
   04921 Oxytocin signaling pathway
    102399487 (NRAS)
   04926 Relaxin signaling pathway
    102399487 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    102399487 (NRAS)
   04919 Thyroid hormone signaling pathway
    102399487 (NRAS)
   04916 Melanogenesis
    102399487 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102399487 (NRAS)
   04726 Serotonergic synapse
    102399487 (NRAS)
   04720 Long-term potentiation
    102399487 (NRAS)
   04730 Long-term depression
    102399487 (NRAS)
   04722 Neurotrophin signaling pathway
    102399487 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102399487 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102399487 (NRAS)
   04213 Longevity regulating pathway - multiple species
    102399487 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102399487 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102399487 (NRAS)
   05206 MicroRNAs in cancer
    102399487 (NRAS)
   05205 Proteoglycans in cancer
    102399487 (NRAS)
   05203 Viral carcinogenesis
    102399487 (NRAS)
   05230 Central carbon metabolism in cancer
    102399487 (NRAS)
   05231 Choline metabolism in cancer
    102399487 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102399487 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102399487 (NRAS)
   05225 Hepatocellular carcinoma
    102399487 (NRAS)
   05226 Gastric cancer
    102399487 (NRAS)
   05214 Glioma
    102399487 (NRAS)
   05216 Thyroid cancer
    102399487 (NRAS)
   05221 Acute myeloid leukemia
    102399487 (NRAS)
   05220 Chronic myeloid leukemia
    102399487 (NRAS)
   05218 Melanoma
    102399487 (NRAS)
   05211 Renal cell carcinoma
    102399487 (NRAS)
   05219 Bladder cancer
    102399487 (NRAS)
   05215 Prostate cancer
    102399487 (NRAS)
   05213 Endometrial cancer
    102399487 (NRAS)
   05224 Breast cancer
    102399487 (NRAS)
   05223 Non-small cell lung cancer
    102399487 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102399487 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102399487 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    102399487 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102399487 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102399487 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    102399487 (NRAS)
   05161 Hepatitis B
    102399487 (NRAS)
   05160 Hepatitis C
    102399487 (NRAS)
   05163 Human cytomegalovirus infection
    102399487 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102399487 (NRAS)
   05165 Human papillomavirus infection
    102399487 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102399487 (NRAS)
   01522 Endocrine resistance
    102399487 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102399487 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102399487 (NRAS)
   04031 GTP-binding proteins [BR:bbub04031]
    102399487 (NRAS)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102399487 (NRAS)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102399487 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102399487 (NRAS)
  Exosomal proteins of breast cancer cells
   102399487 (NRAS)
  Exosomal proteins of colorectal cancer cells
   102399487 (NRAS)
GTP-binding proteins [BR:bbub04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102399487 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 102399487
NCBI-ProteinID: XP_006064867
LinkDB
Position
6
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVV
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggctaaaagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagacgccttttacacactggta
agagaaatacgccagtaccggatgaaaaagctcaacagcagtgatgatggcactcaaggc
tgtatggggctgccatgtgtggtggtgtaa

KEGG   Bubalus bubalis (water buffalo): 112587129
Entry
112587129         CDS       T05912                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04137  Mitophagy - animal
bbub04140  Autophagy - animal
bbub04144  Endocytosis
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04510  Focal adhesion
bbub04540  Gap junction
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04714  Thermogenesis
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05132  Salmonella infection
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112587129
   04012 ErbB signaling pathway
    112587129
   04014 Ras signaling pathway
    112587129
   04015 Rap1 signaling pathway
    112587129
   04370 VEGF signaling pathway
    112587129
   04371 Apelin signaling pathway
    112587129
   04630 JAK-STAT signaling pathway
    112587129
   04068 FoxO signaling pathway
    112587129
   04072 Phospholipase D signaling pathway
    112587129
   04071 Sphingolipid signaling pathway
    112587129
   04151 PI3K-Akt signaling pathway
    112587129
   04150 mTOR signaling pathway
    112587129
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112587129
   04140 Autophagy - animal
    112587129
   04137 Mitophagy - animal
    112587129
  09143 Cell growth and death
   04210 Apoptosis
    112587129
   04218 Cellular senescence
    112587129
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112587129
   04540 Gap junction
    112587129
   04550 Signaling pathways regulating pluripotency of stem cells
    112587129
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112587129
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112587129
   04650 Natural killer cell mediated cytotoxicity
    112587129
   04660 T cell receptor signaling pathway
    112587129
   04662 B cell receptor signaling pathway
    112587129
   04664 Fc epsilon RI signaling pathway
    112587129
   04062 Chemokine signaling pathway
    112587129
  09152 Endocrine system
   04910 Insulin signaling pathway
    112587129
   04929 GnRH secretion
    112587129
   04912 GnRH signaling pathway
    112587129
   04915 Estrogen signaling pathway
    112587129
   04917 Prolactin signaling pathway
    112587129
   04921 Oxytocin signaling pathway
    112587129
   04926 Relaxin signaling pathway
    112587129
   04935 Growth hormone synthesis, secretion and action
    112587129
   04919 Thyroid hormone signaling pathway
    112587129
   04916 Melanogenesis
    112587129
  09156 Nervous system
   04725 Cholinergic synapse
    112587129
   04726 Serotonergic synapse
    112587129
   04720 Long-term potentiation
    112587129
   04730 Long-term depression
    112587129
   04722 Neurotrophin signaling pathway
    112587129
  09158 Development and regeneration
   04360 Axon guidance
    112587129
  09149 Aging
   04211 Longevity regulating pathway
    112587129
   04213 Longevity regulating pathway - multiple species
    112587129
  09159 Environmental adaptation
   04714 Thermogenesis
    112587129
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112587129
   05206 MicroRNAs in cancer
    112587129
   05205 Proteoglycans in cancer
    112587129
   05203 Viral carcinogenesis
    112587129
   05230 Central carbon metabolism in cancer
    112587129
   05231 Choline metabolism in cancer
    112587129
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112587129
  09162 Cancer: specific types
   05210 Colorectal cancer
    112587129
   05225 Hepatocellular carcinoma
    112587129
   05226 Gastric cancer
    112587129
   05214 Glioma
    112587129
   05216 Thyroid cancer
    112587129
   05221 Acute myeloid leukemia
    112587129
   05220 Chronic myeloid leukemia
    112587129
   05218 Melanoma
    112587129
   05211 Renal cell carcinoma
    112587129
   05219 Bladder cancer
    112587129
   05215 Prostate cancer
    112587129
   05213 Endometrial cancer
    112587129
   05224 Breast cancer
    112587129
   05223 Non-small cell lung cancer
    112587129
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112587129
   05022 Pathways of neurodegeneration - multiple diseases
    112587129
  09165 Substance dependence
   05034 Alcoholism
    112587129
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112587129
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112587129
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112587129
   05170 Human immunodeficiency virus 1 infection
    112587129
   05161 Hepatitis B
    112587129
   05160 Hepatitis C
    112587129
   05163 Human cytomegalovirus infection
    112587129
   05167 Kaposi sarcoma-associated herpesvirus infection
    112587129
   05165 Human papillomavirus infection
    112587129
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112587129
   01522 Endocrine resistance
    112587129
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    112587129
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    112587129
   04031 GTP-binding proteins [BR:bbub04031]
    112587129
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    112587129
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112587129
  Exosomal proteins of colorectal cancer cells
   112587129
GTP-binding proteins [BR:bbub04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    112587129
SSDB
Motif
Pfam: Ras Roc
Other DBs
NCBI-GeneID: 112587129
NCBI-ProteinID: XP_025149985
LinkDB
Position
9
AA seq 109 aa
MRKSALTIQLIKNHPMEDNSTMEEGWLSLSSYWKQVVTNGETYLLDTAGQESQHHGDQYM
STREGFPLGVCINNTESFKGIHQPWEQIKWVKDSDGIPVVLVGTSVTWS
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaggaagagtgccctgaccatccagctcattaagaaccaccccatggaggacaactcc
accatggaggaaggttggctgtctctaagttcctactggaagcaagtggtcaccaatggg
gagacctacctactggacacagcaggccaggagagtcagcatcatggagaccagtacatg
agcaccagggagggctttcctctgggtgtttgcatcaacaataccgagtccttcaagggc
atccaccagccctgggagcagatcaagtgggtgaaggactcagatggcatacctgtggtg
ctagtgggaacgagtgtgacctggtcatag

DBGET integrated database retrieval system