KEGG   Bubalus bubalis (water buffalo): 102393179
Entry
102393179         CDS       T05912                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04390  Hippo signaling pathway
bbub04810  Regulation of actin cytoskeleton
bbub05200  Pathways in cancer
bbub05218  Melanoma
bbub05224  Breast cancer
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102393179 (FGF1)
   04014 Ras signaling pathway
    102393179 (FGF1)
   04015 Rap1 signaling pathway
    102393179 (FGF1)
   04390 Hippo signaling pathway
    102393179 (FGF1)
   04151 PI3K-Akt signaling pathway
    102393179 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102393179 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102393179 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102393179 (FGF1)
   05218 Melanoma
    102393179 (FGF1)
   05224 Breast cancer
    102393179 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102393179 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:bbub00536]
    102393179 (FGF1)
Cytokines and growth factors [BR:bbub04052]
 Growth factors
  Growth factors (RTK binding)
   102393179 (FGF1)
Glycosaminoglycan binding proteins [BR:bbub00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102393179 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102393179
NCBI-ProteinID: XP_006058944
LinkDB
Position
9
AA seq 155 aa
MAEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQ
LCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
HWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaaccacgaccttcacggccctgactgagaagtttaacctgcctcta
ggcaattacaagaagcccaagctcctgtattgcagcaacgggggctacttcctgagaatc
ctcccagatggcacagtggatgggacgaaggacaggagcgaccagcacattcagctgcag
ctctgtgccgaaagcataggggaggtgtatattaagagtacggagactggccagttcttg
gccatggacaccgacgggcttttgtacggctcacagacacccaatgaggaatgtttgttc
ctggaaaggttggaggaaaaccattacaacacctacatatccaagaagcatgcagagaag
cattggttcgttggtctcaagaagaatggaaggtctaaactcggtcctcggactcacttc
ggccagaaagccatcttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system