KEGG   Bubalus bubalis (water buffalo): 102393434
Entry
102393434         CDS       T05912                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04024  cAMP signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04137  Mitophagy - animal
bbub04140  Autophagy - animal
bbub04141  Protein processing in endoplasmic reticulum
bbub04210  Apoptosis
bbub04215  Apoptosis - multiple species
bbub04217  Necroptosis
bbub04310  Wnt signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04530  Tight junction
bbub04620  Toll-like receptor signaling pathway
bbub04621  NOD-like receptor signaling pathway
bbub04622  RIG-I-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04657  IL-17 signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub04660  T cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04668  TNF signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04723  Retrograde endocannabinoid signaling
bbub04728  Dopaminergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04917  Prolactin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04926  Relaxin signaling pathway
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05012  Parkinson disease
bbub05016  Huntington disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05132  Salmonella infection
bbub05133  Pertussis
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05161  Hepatitis B
bbub05162  Measles
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05231  Choline metabolism in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102393434 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102393434 (MAPK8)
   04012 ErbB signaling pathway
    102393434 (MAPK8)
   04014 Ras signaling pathway
    102393434 (MAPK8)
   04310 Wnt signaling pathway
    102393434 (MAPK8)
   04668 TNF signaling pathway
    102393434 (MAPK8)
   04068 FoxO signaling pathway
    102393434 (MAPK8)
   04071 Sphingolipid signaling pathway
    102393434 (MAPK8)
   04024 cAMP signaling pathway
    102393434 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102393434 (MAPK8)
   04137 Mitophagy - animal
    102393434 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    102393434 (MAPK8)
   04215 Apoptosis - multiple species
    102393434 (MAPK8)
   04217 Necroptosis
    102393434 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102393434 (MAPK8)
   04530 Tight junction
    102393434 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102393434 (MAPK8)
   04621 NOD-like receptor signaling pathway
    102393434 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    102393434 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    102393434 (MAPK8)
   04660 T cell receptor signaling pathway
    102393434 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    102393434 (MAPK8)
   04659 Th17 cell differentiation
    102393434 (MAPK8)
   04657 IL-17 signaling pathway
    102393434 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    102393434 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102393434 (MAPK8)
   04920 Adipocytokine signaling pathway
    102393434 (MAPK8)
   04912 GnRH signaling pathway
    102393434 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    102393434 (MAPK8)
   04917 Prolactin signaling pathway
    102393434 (MAPK8)
   04926 Relaxin signaling pathway
    102393434 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    102393434 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    102393434 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    102393434 (MAPK8)
   04722 Neurotrophin signaling pathway
    102393434 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102393434 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102393434 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102393434 (MAPK8)
   05231 Choline metabolism in cancer
    102393434 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102393434 (MAPK8)
   05212 Pancreatic cancer
    102393434 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102393434 (MAPK8)
   05012 Parkinson disease
    102393434 (MAPK8)
   05016 Huntington disease
    102393434 (MAPK8)
   05017 Spinocerebellar ataxia
    102393434 (MAPK8)
   05020 Prion disease
    102393434 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    102393434 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102393434 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102393434 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    102393434 (MAPK8)
   04931 Insulin resistance
    102393434 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102393434 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102393434 (MAPK8)
   05135 Yersinia infection
    102393434 (MAPK8)
   05133 Pertussis
    102393434 (MAPK8)
   05152 Tuberculosis
    102393434 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102393434 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    102393434 (MAPK8)
   05161 Hepatitis B
    102393434 (MAPK8)
   05171 Coronavirus disease - COVID-19
    102393434 (MAPK8)
   05162 Measles
    102393434 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102393434 (MAPK8)
   05169 Epstein-Barr virus infection
    102393434 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102393434 (MAPK8)
   05142 Chagas disease
    102393434 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102393434 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102393434 (MAPK8)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102393434 (MAPK8)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102393434 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 102393434
NCBI-ProteinID: XP_006066864
LinkDB
Position
4
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSR
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggttcaggagcccaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaacgttgcaatcaagaagttaagtcggcca
tttcagaatcaaactcatgctaagcgtgcttacagagagctagttcttatgaaatgtgta
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgtcaagtgattcag
atggagctagatcatgaaagaatgtcctacctgctctatcagatgctgtgtgggatcaag
caccttcactctgctggaattattcaccgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggaccgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctaggcatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaga
atgctggtaatcgacgcatctaaaaggatttctgtagacgaagctctccagcacccgtat
atcaatgtctggtatgacccttctgaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt
atggacttggaggaaagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtcc
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

KEGG   Bubalus bubalis (water buffalo): 102396572
Entry
102396572         CDS       T05912                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04024  cAMP signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04137  Mitophagy - animal
bbub04140  Autophagy - animal
bbub04141  Protein processing in endoplasmic reticulum
bbub04210  Apoptosis
bbub04215  Apoptosis - multiple species
bbub04217  Necroptosis
bbub04310  Wnt signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04530  Tight junction
bbub04620  Toll-like receptor signaling pathway
bbub04621  NOD-like receptor signaling pathway
bbub04622  RIG-I-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04657  IL-17 signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub04660  T cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04668  TNF signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04723  Retrograde endocannabinoid signaling
bbub04728  Dopaminergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04917  Prolactin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04926  Relaxin signaling pathway
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05012  Parkinson disease
bbub05016  Huntington disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05132  Salmonella infection
bbub05133  Pertussis
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05161  Hepatitis B
bbub05162  Measles
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05231  Choline metabolism in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102396572 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102396572 (MAPK10)
   04012 ErbB signaling pathway
    102396572 (MAPK10)
   04014 Ras signaling pathway
    102396572 (MAPK10)
   04310 Wnt signaling pathway
    102396572 (MAPK10)
   04668 TNF signaling pathway
    102396572 (MAPK10)
   04068 FoxO signaling pathway
    102396572 (MAPK10)
   04071 Sphingolipid signaling pathway
    102396572 (MAPK10)
   04024 cAMP signaling pathway
    102396572 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102396572 (MAPK10)
   04137 Mitophagy - animal
    102396572 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    102396572 (MAPK10)
   04215 Apoptosis - multiple species
    102396572 (MAPK10)
   04217 Necroptosis
    102396572 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102396572 (MAPK10)
   04530 Tight junction
    102396572 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102396572 (MAPK10)
   04621 NOD-like receptor signaling pathway
    102396572 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    102396572 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    102396572 (MAPK10)
   04660 T cell receptor signaling pathway
    102396572 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    102396572 (MAPK10)
   04659 Th17 cell differentiation
    102396572 (MAPK10)
   04657 IL-17 signaling pathway
    102396572 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    102396572 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102396572 (MAPK10)
   04920 Adipocytokine signaling pathway
    102396572 (MAPK10)
   04912 GnRH signaling pathway
    102396572 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    102396572 (MAPK10)
   04917 Prolactin signaling pathway
    102396572 (MAPK10)
   04926 Relaxin signaling pathway
    102396572 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    102396572 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    102396572 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    102396572 (MAPK10)
   04722 Neurotrophin signaling pathway
    102396572 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102396572 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102396572 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102396572 (MAPK10)
   05231 Choline metabolism in cancer
    102396572 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102396572 (MAPK10)
   05212 Pancreatic cancer
    102396572 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102396572 (MAPK10)
   05012 Parkinson disease
    102396572 (MAPK10)
   05016 Huntington disease
    102396572 (MAPK10)
   05017 Spinocerebellar ataxia
    102396572 (MAPK10)
   05020 Prion disease
    102396572 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    102396572 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102396572 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102396572 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    102396572 (MAPK10)
   04931 Insulin resistance
    102396572 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102396572 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102396572 (MAPK10)
   05135 Yersinia infection
    102396572 (MAPK10)
   05133 Pertussis
    102396572 (MAPK10)
   05152 Tuberculosis
    102396572 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102396572 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    102396572 (MAPK10)
   05161 Hepatitis B
    102396572 (MAPK10)
   05171 Coronavirus disease - COVID-19
    102396572 (MAPK10)
   05162 Measles
    102396572 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102396572 (MAPK10)
   05169 Epstein-Barr virus infection
    102396572 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102396572 (MAPK10)
   05142 Chagas disease
    102396572 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102396572 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102396572 (MAPK10)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102396572 (MAPK10)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102396572 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102396572
NCBI-ProteinID: XP_025145541
LinkDB
Position
7
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctatagcgtggaagtgggagactcaacgttcacggtt
ctcaaacgctatcagaatctaaagcctattggctctggggctcagggaatagtctgcgct
gcgtatgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcctaccgggagctggtcctcatgaagtgtgtgaatcat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacactggaggagttccaa
gatgtttacttagtaatggaactgatggatgctaacttgtgtcaggtgattcagatggag
ttagaccacgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt
cactctgctgggattattcacagggacttaaaaccaagtaacattgtagtcaagtctgat
tgtacactgaaaatcctagactttgggctggccagaacagcaggcacaagcttcatgatg
actccctatgtggtaacacgttattaccgggcccccgaggtcattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctgtttccaggaagggactatattgaccagtggaataaggttattgagcaactagga
acaccatgtccagaattcatgaagaaattgcaacccaccgtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccctaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagagacttgctgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggatgatgccttacaacatccgtacatcaat
gtctggtacgaccctgctgaagtggaggcgcccccacctcagatatacgacaaacagctg
gatgaaagagaacacaccattgaagaatggaaagaacttatctataaggaagtaatgaac
tcagaagaaaagacgaagaacggcgttgtgaaaggacagccttctccttcaggtgcagcc
gtgaacagcagtgagagcctccctccttcctcatccgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

KEGG   Bubalus bubalis (water buffalo): 102403452
Entry
102403452         CDS       T05912                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04024  cAMP signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04137  Mitophagy - animal
bbub04140  Autophagy - animal
bbub04141  Protein processing in endoplasmic reticulum
bbub04210  Apoptosis
bbub04215  Apoptosis - multiple species
bbub04217  Necroptosis
bbub04310  Wnt signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04530  Tight junction
bbub04620  Toll-like receptor signaling pathway
bbub04621  NOD-like receptor signaling pathway
bbub04622  RIG-I-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04657  IL-17 signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub04660  T cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04668  TNF signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04723  Retrograde endocannabinoid signaling
bbub04728  Dopaminergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04917  Prolactin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04926  Relaxin signaling pathway
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05012  Parkinson disease
bbub05016  Huntington disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05132  Salmonella infection
bbub05133  Pertussis
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05161  Hepatitis B
bbub05162  Measles
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05231  Choline metabolism in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102403452 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102403452 (MAPK9)
   04012 ErbB signaling pathway
    102403452 (MAPK9)
   04014 Ras signaling pathway
    102403452 (MAPK9)
   04310 Wnt signaling pathway
    102403452 (MAPK9)
   04668 TNF signaling pathway
    102403452 (MAPK9)
   04068 FoxO signaling pathway
    102403452 (MAPK9)
   04071 Sphingolipid signaling pathway
    102403452 (MAPK9)
   04024 cAMP signaling pathway
    102403452 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102403452 (MAPK9)
   04137 Mitophagy - animal
    102403452 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    102403452 (MAPK9)
   04215 Apoptosis - multiple species
    102403452 (MAPK9)
   04217 Necroptosis
    102403452 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102403452 (MAPK9)
   04530 Tight junction
    102403452 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102403452 (MAPK9)
   04621 NOD-like receptor signaling pathway
    102403452 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    102403452 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    102403452 (MAPK9)
   04660 T cell receptor signaling pathway
    102403452 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    102403452 (MAPK9)
   04659 Th17 cell differentiation
    102403452 (MAPK9)
   04657 IL-17 signaling pathway
    102403452 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    102403452 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102403452 (MAPK9)
   04920 Adipocytokine signaling pathway
    102403452 (MAPK9)
   04912 GnRH signaling pathway
    102403452 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    102403452 (MAPK9)
   04917 Prolactin signaling pathway
    102403452 (MAPK9)
   04926 Relaxin signaling pathway
    102403452 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    102403452 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    102403452 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    102403452 (MAPK9)
   04722 Neurotrophin signaling pathway
    102403452 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102403452 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102403452 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102403452 (MAPK9)
   05231 Choline metabolism in cancer
    102403452 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102403452 (MAPK9)
   05212 Pancreatic cancer
    102403452 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102403452 (MAPK9)
   05012 Parkinson disease
    102403452 (MAPK9)
   05016 Huntington disease
    102403452 (MAPK9)
   05017 Spinocerebellar ataxia
    102403452 (MAPK9)
   05020 Prion disease
    102403452 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    102403452 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102403452 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102403452 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    102403452 (MAPK9)
   04931 Insulin resistance
    102403452 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102403452 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102403452 (MAPK9)
   05135 Yersinia infection
    102403452 (MAPK9)
   05133 Pertussis
    102403452 (MAPK9)
   05152 Tuberculosis
    102403452 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102403452 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    102403452 (MAPK9)
   05161 Hepatitis B
    102403452 (MAPK9)
   05171 Coronavirus disease - COVID-19
    102403452 (MAPK9)
   05162 Measles
    102403452 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102403452 (MAPK9)
   05169 Epstein-Barr virus infection
    102403452 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102403452 (MAPK9)
   05142 Chagas disease
    102403452 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102403452 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102403452 (MAPK9)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102403452 (MAPK9)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102403452 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102403452
NCBI-ProteinID: XP_025149760
LinkDB
Position
9
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagcgacagcaaatgtgatagtcagttttacagtgtgcaagtggcagactcaactttc
acagtcctaaagcgataccagcagttgaaaccaattggctctggagcccaaggaattgtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcagactcatgcaaagagagcatatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctacattcagctggtataattcatagagatctgaagcctagtaacattgtagtcaag
tcagactgcaccctgaagatcctcgactttggcctggctcgcacagcgtgcaccaacttt
atgatgactccctatgtggtcacgcggtattaccgggcacccgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag
ctaggaacaccatctgcagatttcatgaagaaacttcagccaactgtgaggaattatgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgaacgagacaaaattaaaacaagtcaagccagagacttattatcaaaa
atgttagtgatagatcccgacaagcgaatctctgtagatgaagctttgcgtcacccttat
atcactgtttggtatgaccctgctgaagcagaagcgccaccaccccaaatttatgatgcc
cagttggaagagagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtg
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcaaccctcagatgcagca
gtaagcagcaacgccactccttctcagtcgtcgtccatcaatgacatttcatccatgtcc
acggagcagacgctggcctcggacacagacagcagtctggacgcctcgacaggacccctg
gaaggctgtcgatga

DBGET integrated database retrieval system