KEGG   Bubalus bubalis (water buffalo): 102393584Help
Entry
102393584         CDS       T05912                                 

Gene name
GK
Definition
(RefSeq) glycerol kinase isoform X3
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00561  Glycerolipid metabolism
bbub01100  Metabolic pathways
bbub03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102393584 (GK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102393584 (GK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102393584 (GK)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     102393584 (GK)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102393584 (GK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-GeneID: 102393584
NCBI-ProteinID: XP_006056351
LinkDB All DBs
Position
X
AA seq 559 aa AA seqDB search
MASAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGASGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEIPMKILPNVRSSSEIY
GLMKISHSPKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGRKCV
FSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSL
EPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSSESGDPSIFCSLPLGF
FIVSSVVMLIGARYLSGMP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgcgaagaaagcagtgttggggcccttggtgggagcagtggaccagggcacc
agctcgacgcgctttctggttttcaattcaaaaacagccgaactacttagtcatcatcaa
gtggaaataaaacaagagtttccaagagaagggtgggtggagcaggaccctaaggaaatt
ctgcagtctgtctatgagtgtatagagaaaacgtgtgagaaactcgggcagctcaatatt
gatatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtagtctgg
gacaagttaactggagaacctctctacaacgctgtggtgtggcttgatctaagaacccag
tctactgttgagagtcttagtaaaagaatcccaggaaataataactttgtcaagtccaag
acaggccttccacttagcacttatttcagtgcggtgaagcttcgttggctccttgacaat
gtgagaaaagttcaaaaggccgttgaagaagatagagctctttttgggaccattgattca
tggcttatttggagcttgacaggaggagccagtggaggggtccattgtacagatgtaaca
aatgcaagcaggacaatgcttttcaacatccattctttggaatgggataaagagctctgc
gaattttttgaaattccaatgaaaattcttccaaatgtccggagttcttcagagatctat
ggcctaatgaaaatctctcatagcccgaaagctggggccttggaaggtgtgccaatatct
gggtgtttgggagaccagtctgctgcgttggtaggacaaatgtgcttccaagatggacaa
gccaaaaacacgtatggaacaggctgcttcttactatgtaatacaggccgtaagtgtgta
ttttctgaacatggccttctgaccacagtggcttacaaactcggcagagataaacccgta
tattatgcattagaaggttcagtagctatagctggtgctgttattcgctggcttagagac
aatcttggaattataaaaagctccgaggaaattgaaaaacttgctaaagaagtaggtact
tcttatggctgctatttcgtcccagcattttcggggctgtatgcaccttattgggagccc
agtgcaagagggatcatctgtgggctcactcagttcaccaataaatgccatattgctttt
gctgcattagaagctgtttgtttccaaactcgagagattttggacgccatgaaccgtgac
tgtggaattccactcagccatttgcaggtagacggtggaatgaccaacaacaaaatcctt
atgcagttacaagcagacattctgtatattccagtagtgaaaccatccatgcctgaaaca
actgctctgggagctgccatggctgcgggggctgcagaaggggttggcgtctggagtctg
gagcctgaggacttgtcggctgtcacaatggagcgatttgaacctcaaatcaacgctgag
gaaagtgaaattcgttattctacatggaagaaagctgtgatgaagtcaatgggttgggtt
acaactcagtcttcagaaagtggtgaccctagtatcttctgtagtctgcccttgggcttt
tttatagtgagtagcgtggtaatgttaatcggagcaaggtacctctcaggtatgccgtaa

KEGG   Bubalus bubalis (water buffalo): 102400306Help
Entry
102400306         CDS       T05912                                 

Gene name
GK2
Definition
(RefSeq) glycerol kinase 2
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00561  Glycerolipid metabolism
bbub01100  Metabolic pathways
bbub03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102400306 (GK2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102400306 (GK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102400306 (GK2)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     102400306 (GK2)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102400306 (GK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-GeneID: 102400306
NCBI-ProteinID: XP_006053808
LinkDB All DBs
Position
7
AA seq 596 aa AA seqDB search
MAPAPYDEPDAVDVLRAPPRPTPPSPGKRETAPEQLSRPTGFMAAPKTAAGGPLVGALVQ
GTDYSNFMVFNSKTSEVLSHHRVELTQEVPKEGWIEQDPKQILQSVNECIEKTCEKLQEL
NIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVMWLDVRTQSTVETLSKKIPGNNNFVK
SKTGLPLSTYFSAVKLRWILDNVRKAQKAVEEGRALFGTVDSWLIWSLTGGVDGGIHCTD
VTNASRTMLFNIHSLEWDKELCDFFEIPMDILPNIWSSSEIYGRVKTGTLEGVPISGCLG
DQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGHKCVFSECGLLTTVAYKLGKNKPVFYAL
EGSVAIGGAVIHWLRDNLGIIKTSEESEKLAKEVGTSYGCYFIPAFSGLYAPYWEPTARG
IICGLTQFTNKSHIAFAALEAICFQTREILDAMNRDCGIPLSHLQVDGEMTNNKVLMQLQ
ADILHIPVIKASMPETMALGAAMAAGAAEGVNVWSLKPEDLSTIMMERFEPQIKARESEI
RYSTWKKAVMKSMGWVTGQPSESSEANNFSSLPLGFFIVTSMIMLIGARYISSIFS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggcgccttatgatgagcctgacgctgttgacgtcctgcgtgcccctccccga
ccaacacctccatcaccagggaaacgagaaacggcaccagagcagctgagccgacccact
ggtttcatggcggctccgaaaacagcagctggggggccgttggtgggggccttggtccag
ggtacggactactctaattttatggttttcaattcaaaaacatcagaagtacttagtcac
catcgagtggaattaacccaagaggtcccaaaagaaggatggatagaacaagatcctaag
caaattcttcagtctgttaatgaatgtatagagaaaacatgtgagaaacttcaagaactg
aatattgatatatccaacataaaggctataggtgtcagcaatcagagggaaaccaccgtg
gtctgggacaaattaactggtgagccgctctataatgctgtgatgtggcttgatgtaaga
acccagtctactgttgagactcttagtaaaaaaattccaggaaataataacttcgtcaag
tccaagacaggtcttccacttagcacttacttcagcgcagtgaaacttcgttggattctt
gacaatgtgagaaaagctcaaaaggctgttgaagaaggcagagctctttttggtactgtt
gattcatggcttatctggagtctgacgggaggagttgatggaggtatccattgcacagat
gtaacaaatgcgagcaggacgatgctcttcaacatccattctttagaatgggataaagag
ctgtgtgatttttttgaaattccaatggacattcttccaaatatctggagttcttctgaa
atctatggacgagtgaaaactgggaccctggaaggtgtgccaatatctggatgcttgggg
gaccagtctgctgcgttagtaggacaaatgtgcttccaggaaggacaagccaaaaacacg
tatgggacaggctgcttcttactatgtaatacaggtcataaatgcgtgttttctgaatgt
ggcctcctgaccacagtggcttacaagctaggcaaaaacaaacccgttttttatgcactg
gaaggttctgtggccataggcggtgctgttattcactggctgagagacaatcttggaatt
ataaaaacctctgaagaaagtgaaaaacttgctaaagaagtaggtacttcttatggctgc
tacttcatcccggccttttcagggttatatgcaccttattgggagcccactgcaagaggg
atcatctgtgggctcactcagttcaccaataagagtcatattgcttttgccgcattggaa
gctatttgtttccaaacccgagagattctggatgccatgaaccgtgactgtggaattccg
ctcagtcatttgcaggtggatggagaaatgacgaacaacaaagttcttatgcaactgcaa
gcagacattctgcatattccagtaataaaagcctccatgcctgaaacaatggcactggga
gctgccatggcagcaggagctgcagaaggggtgaacgtctggagccttaaacccgaggat
ttgtcaaccatcatgatggaacggtttgaaccacagatcaaagccagagaaagtgaaatt
cgttattctacatggaagaaagctgtgatgaagtcaatgggttgggttacaggtcagcct
tctgaaagtagtgaagctaataacttctctagtctgcccttgggtttttttatagtgact
agcatgataatgttaattggagcaagatacatctcaagtatattttcataa

KEGG   Bubalus bubalis (water buffalo): 102409738Help
Entry
102409738         CDS       T05912                                 

Definition
(RefSeq) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00561  Glycerolipid metabolism
bbub01100  Metabolic pathways
bbub03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102409738
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102409738
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102409738
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     102409738
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102409738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGGY_N FGGY_C
Motif
Other DBs
NCBI-GeneID: 102409738
NCBI-ProteinID: XP_006079704
LinkDB All DBs
Position
2
AA seq 553 aa AA seqDB search
MAATKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPKEGWVEQDPKEI
LLSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVESLSKSIPVNNNFVKTKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGAHGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFKVPMKILPNIRSSSEIY
GLMKAGSLEGVPISGCLGDQSAALVGQLCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVVRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLS
AVTMERFEPQINAKESEIRYSTWKKAVMKSMDWATTKSSENGDTGIFSSLPLGFFVVSSM
VMLIGARYLSGVP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagccacgaagaaagcagttttggggccgttggtgggagcagtggaccagggcacc
agctcgacgcgctttttggttttcaattcaaaaacagccgaactacttagtcatcatcaa
gtggaaataaaacaagagtttcctaaagaaggatgggtggaacaagaccctaaggaaatc
ctgctgtccgtgtatgagtgtatagagaaaacgtgtgagaagcttggacagctcaatatt
gatatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtagtctgg
gacaaattaactggagaacctctatacaatgctgtggtgtggctcgatctgagaacccag
tctaccgttgaaagtcttagtaaaagcattccagtaaataacaactttgtcaagaccaag
acgggccttccactgagcacttacttcagcgcagtgaaacttcgttggcttcttgacaac
gtgagaaaagttcaaaaggcagttgaagaagatagagcgctttttgggaccattgattca
tggcttatttggagcttgacaggaggagcccatggaggtgtccattgtacagatgtaaca
aatgcaagcaggacgatgcttttcaacattcactctttggaatgggataaagagctctgt
gagttttttaaagttccaatgaaaattcttccaaatatccggagttcttctgagatctat
ggcctaatgaaagctgggtctttggaaggtgtgcccatatcggggtgtctgggggaccag
tctgctgcattggtgggacaactgtgcttccaggatggacaagccaaaaacacgtatgga
acaggctgtttcttactatgcaatacaggccataagtgtgtattttctgaacatggcctt
ctgaccacagtggcttacaagctcggcagagacaaaccagtatattatgcactagaaggt
tcggtagctatagctggtgctgttgttcgctggctaagggacaatcttggaattataaag
acctcagaggaaattgaaaaacttgctaaagaagtaggtacctcttatggttgctatttt
gtcccagccttttcaggcctatatgccccttattgggagcccagtgccagagggatcatc
tgtgggctcactcagttcaccaataaatgccatattgcttttgctgcactagaggctgtt
tgttttcaaacccgagaaattctggatgccatgaaccgcgactgtggaattccactcagt
cacttgcaggtggacggagggatgaccaacaacaaaattttgatgcaactgcaagccgac
atcctgtatatcccggtagtgaagccctcgatgccggaaacaactgccttgggagctgcc
atggcagcaggggccgcagaaggggtcggcgtgtggagtctcgagcctgaggatttgtca
gctgtcacgatggagcggtttgaacctcagatcaacgccaaggagagcgaaattcgttat
tccacatggaagaaagctgtaatgaagtccatggattgggctaccactaagtcttcagaa
aatggtgacactggaatcttcagtagtctacccttgggcttttttgtagtgagtagcatg
gtaatgttaatcggagccaggtacctctcaggtgtgccataa

DBGET integrated database retrieval system