KEGG   Bubalus bubalis (water buffalo): 102393841Help
Entry
102393841         CDS       T05912                                 

Gene name
CAB39L
Definition
(RefSeq) calcium-binding protein 39-like isoform X1
  KO
K08272  calcium binding protein 39
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04150  mTOR signaling pathway
bbub04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102393841 (CAB39L)
   04150 mTOR signaling pathway
    102393841 (CAB39L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mo25 CC2-LZ
Motif
Other DBs
NCBI-GeneID: 102393841
NCBI-ProteinID: XP_006063645
LinkDB All DBs
Position
13
AA seq 353 aa AA seqDB search
MIQTSKHSILHEEISIDEKMPLFSKSHKNPAEIVKILRDNLAILEKQDKKTDKASEEVSK
SLQAMKEILCGTSDKEPPVEAVAQLSQELYTTGLLVTLIADLQLIDFEGKKDVTQIFNNI
LRRQIGTRIPTVEYISAHPHILFMLLKGYEVPQIALRCGIMLRECIRHEPLAKIILFSNQ
FQDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVT
KRQSLKLLGELILDRHNFTIMTKYISKPENLKLTMNLLRDKSPNIQFEAFHVFKVFVASP
HKTQPIVEILLKNQPKLIEFLSNFQKERTDDEQFTDEKNYLIKQIRDLKKVAP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaacttctaagcattctatattgcatgaagagatttctatagatgaaaaaatg
cctctgtttagtaaatcacacaaaaatccagcagaaatcgtgaaaattctgagagacaac
ttggccattttggaaaagcaagacaaaaagacagataaggcttcagaagaagtgtcaaaa
tcactgcaagcaatgaaagaaattctgtgtgggacaagtgacaaggagcccccagtggaa
gctgtggcccagctctcacaggagctctacaccaccgggctgttggtgacactcatagcc
gacctacagctgatagactttgagggaaaaaaggatgtgacccagatatttaacaacatc
ctgagaagacagataggcactcggattcctaccgtggagtacattagtgctcatcctcac
atcctgtttatgctcctcaaaggctatgaagtcccacagatcgccttacgttgtggtatt
atgctgagagaatgtattcgacatgaaccacttgccaaaatcatcctcttttctaatcaa
ttccaagatttctttaagtatgtcgaactgtcaacatttgatatcgcttcagatgccttt
gctacttttaaggatttactaaccagacataaagtgttggtagcagacttcttagaacaa
aattatgacactatttttgaagactatgagaaactgcttcagtctgagaattatgtgact
aagagacaatctttgaagctgctaggtgaactgatcctggaccggcacaactttaccatc
atgaccaagtacatcagcaagccagagaacctcaaactgacgatgaacctcctccgggat
aaaagccccaacatccagtttgaagcctttcacgtctttaaggtgtttgtggccagtcct
cacaaaacacagcctattgtggagattcttctgaaaaaccaacccaaactcatcgagttt
ctgagcaacttccaaaaagaaaggaccgacgacgagcagttcactgatgagaagaactac
ctgattaaacagattcgtgacctgaagaaggtggccccttga

KEGG   Bubalus bubalis (water buffalo): 102394957Help
Entry
102394957         CDS       T05912                                 

Gene name
CAB39
Definition
(RefSeq) calcium-binding protein 39
  KO
K08272  calcium binding protein 39
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04150  mTOR signaling pathway
bbub04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102394957 (CAB39)
   04150 mTOR signaling pathway
    102394957 (CAB39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mo25
Motif
Other DBs
NCBI-GeneID: 102394957
NCBI-ProteinID: XP_025134221
LinkDB All DBs
Position
2
AA seq 341 aa AA seqDB search
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcccattcgggaagtctcacaagtcccctgcagacatcgtgaagaacctgaag
gagagcatggctgtgctggagaagcaagacatttccgacaaaaaggcagaaaaggctaca
gaagaagtttccaagaatctggttgccatgaaggaaattctatatggcacaaatgagaag
gagccgcagacagaggcagtggcacagctcgcccaagaactgtataacagtgggcttctc
agcaccctggtagctgatttgcagctcattgactttgagggcaagaaagacgtggctcaa
attttcaacaatattctcagaagacaaattggtacaagaactcctactgttgaatacatc
tgcacccagcagaatattttgttcatgttgttgaaagggtatgaatctccagaaatagcc
ctaaattgtggaataatgttaagagaatgcatcagacatgaaccacttgcaaaaatcatt
ttgtggtcggaacagttttatgatttcttcagatatgtcgaaatgtcaacatttgacata
gcttcagatgcatttgccacattcaaggatttacttacaagacataaattgctcagtgcg
gaatttttggaacaacattatgatagattcttcagtgaatatgagaagttacttcattca
gaaaattatgtgacaaaaagacagtcactcaagcttctcggtgaattgctactagacaga
cacaacttcacgattatgacaaaatacatcagtaaacctgagaacctcaaattaatgatg
aaccttctacgagacaaaagccgtaacatccagtttgaggccttccacgtttttaaggtg
ttcgtagccaaccccaacaagacgcagcccatccttgacatcctcctcaagaaccaagcc
aagctcatagagttcctcagcaagttccagaatgacaggaccgaggatgagcagttcaat
gacgagaagacgtatttagtcaaacagatcagggatttgaagagaccagctcagcaagaa
gcctga

DBGET integrated database retrieval system