KEGG   Bubalus bubalis (water buffalo): 102393858Help
Entry
102393858         CDS       T05912                                 

Gene name
NRIP1
Definition
(RefSeq) nuclear receptor-interacting protein 1
  KO
K17965  nuclear receptor-interacting protein 1
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bbub03029]
    102393858 (NRIP1)
Mitochondrial biogenesis [BR:bbub03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102393858 (NRIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NRIP1_repr_4 NRIP1_repr_1 NRIP1_repr_2 NRIP1_repr_3
Motif
Other DBs
NCBI-GeneID: 102393858
NCBI-ProteinID: XP_025138042
LinkDB All DBs
Position
1
AA seq 1156 aa AA seqDB search
MTHGEELGSDVHQDSIVLTYLEGLLMHQAAEGSGTAVDKASAGRNEDDQNFNISGSAFPT
CQRNGPVLSTHTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIVNLNVKKEALLAGMA
DSAPKGKQDSKVLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHNSLKVEKDLRCYGV
ASSHLKTLLKKSKAKDQKPDTNVPDVTKTLIRDRFIESPHHVGQSGTKVMSEPLSCAARL
QAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAA
MARLQENGQKDMGSFQLSKGISGHLNGQARTSSNKLMASKSTAFQNPVGIVPSSPKNAGY
KNSLERNNIKQAANNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDDYSDPNP
SFTDESSGDESSYSNCVPIDLSCKHRIEKPEPDQPVSLDNLTQSLLNTWDPKVPEVDVKE
DQDTSKNSKLNSHQKVTLLQLLLGHKNEENMERNGSPQEAHSDETKFSTQNYTRTSVIES
PSTNRTTPVSTPPLLASTKADSPINLSQHSLVIKWNSPPYACGPQPEKPASTASNHLMDL
TKSKESQGEKAIHNEGAQNSATFSASKLLQNLAQCGMQSSVSGEEQRPSKQLLSVNTDKP
PGMIDRLNSPLLANKTSAVEEKKVFGSHTVGPEPGLSGSEIENLLERRTVLQLLLGNPNK
GKTEKKEKMPLRDESTQEHTDRALSEQILMVKIKSEPCDDLRLHATGTHLSHEAPGVPFL
GMAPPMQRSAPALPASEDLKPEPGSPQDFSFSKNGLLSRLLRQNQDSHLADELDSSHRNS
ELTLVESKNLCMVPKKRKLYTEPLENPFKKMKNNTVDAANSHSAPEVLYGSLLNQQELKL
SRSDLEFKHPASHGSASESEPRNWTRESKSFNVLKQLLLSENCVRDLSQHRSNSVADSKK
KGHRNSMTNSKPEFSIASLNGLMCGATQPGGCMVSRTFPYPGIGKAPRSPPFPEHLGCAG
SRPEAGLVNGCSMPSEKGPIKWVITDVDKNEYEKDSPRLTKTNPILYYMLQKGGTSVTSR
ETQDRDIWREPSSAESISQVTIKEELLPAAETKASFFNLRSTYNSHMGNNASLPQSANGE
VYGLLGNMLTIKKESE
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atgactcatggagaagagctgggctctgatgtgcaccaggattctattgttctaacttac
ctagaaggattactaatgcatcaggcagcagaggggtcaggtactgccgtcgacaaagcg
tctgccgggcgtaatgaagacgatcagaactttaacatttctggtagcgcgtttcccacc
tgtcagcgtaatggtccagttctcagcacacacacatatcagggatctggcatgctgcac
ctcaaaaaagccagactcttgcagtcttctgaggactggaacgcagcgaagcggaagagg
ctgtctgattccatcgtaaatttaaacgtaaagaaggaggctctgctggctggcatggct
gacagtgcgcctaaaggcaaacaggacagcaaggtactggcctctctgcttcagtcgttc
agctctaggctgcagactgttgccctgtcacaacaaattaggcagagcctcaaggagcaa
ggatacgccctgagtcataattctttaaaagtggagaaagatttaaggtgctatggggtt
gcatcaagtcacttaaaaactctgttgaagaaaagcaaggctaaagatcaaaagcctgat
accaacgtccctgatgtcacgaaaacccttatcagagacaggttcatagagtcacctcat
cacgttgggcagagcggaacaaaggtcatgagcgagcccttgtcatgtgctgcaagattg
caggctgtcgcaagcatggtggagaaaagggccagtcctgccacttcacccaaacccagt
gttgcctgtagccaactagcactacttctctccagcgaagcccatttacagcagtattct
cgagaacatgctttaaaaacacaaaatgcaaatcaggcagcaagcgaaagacttgctgcc
atggccagattacaagaaaatggccagaaggacatgggcagtttccagctctcaaaaggc
atatcaggccatcttaatggtcaggcaagaacatcatcaaacaaactaatggctagcaaa
agtacagcatttcagaatccagtgggtattgtcccttcttcccccaaaaatgcaggctat
aagaactccctggaaagaaacaatataaaacaggctgctaataacagtttgcttttacat
cttcttaaaagccagaccatacctaagccgatgaacggacacagtcacagtgagagagga
agcatttttgaggagagcagcacacctacgactattgatgactactcagatcccaatcct
agtttcaccgatgagagcagtggcgatgaaagttcttactccaactgtgttcccatagac
ttgtcttgcaaacaccggatagaaaaacccgaacccgaccagcctgtttctctggataac
ttaactcagtccttgctaaacacttgggatccaaaagtccccgaagttgacgtcaaagaa
gatcaagatacctcaaagaattctaagctaaattcacaccagaaagtaacccttcttcag
ttgctgcttggccataagaatgaagaaaacatggaaagaaacggcagccctcaggaagca
cacagcgatgagacaaagttcagcacacagaattacacccggacgtctgtaatagaaagc
cccagcaccaacaggactacccccgtgagcactcctccattgcttgcatccaccaaagcc
gactcccccatcaacctttcccaacactctctggtcatcaaatggaattccccaccatat
gcctgtggtccccagcctgaaaagccagcgagtaccgcctcgaaccacctgatggacctt
acaaaaagcaaagaatcgcagggggagaaagccatccacaatgaaggtgcacaaaactcg
gccacgttcagtgccagtaaactgttacaaaatttagcgcaatgtggaatgcagtcttcc
gtgtcaggggaagagcagagacccagtaaacagctgctgagtgtaaacacagataaacct
ccaggtatgattgatagactgaatagccctctgcttgccaataaaacaagtgcagttgaa
gagaagaaagtgttcggcagtcacacagtaggtcctgaaccaggactttctgggtctgaa
atagaaaatctgcttgaaaggcgcaccgtcctccagttactgctgggaaatcccaacaaa
gggaagactgaaaagaaagagaagatgcccttaagagatgagagcactcaggaacataca
gatagagctttaagtgaacaaatactgatggtgaaaataaaatctgagccttgtgatgac
ttgcgtctgcatgccacgggcacacacttgagccatgaggctccgggcgtccccttccta
gggatggcccctcccatgcagagaagcgcacctgccttaccagcatccgaggacttgaaa
ccagagcctggctcacctcaggatttttctttctctaagaatggtctgctgagtcgattg
ctgagacaaaatcaagacagtcacctggctgatgagctggacagcagtcacagaaatagt
gaactgacacttgtagaatcgaagaacctttgcatggtccctaagaaaaggaagctttac
accgagccgttagaaaacccctttaaaaagatgaaaaataacacagtcgatgctgcaaac
agtcacagtgctccagaggtgctgtatgggtccttgcttaaccagcaagagctgaaactt
agcagaagtgatcttgagtttaagcatcctgccagtcacggttcggccagcgaaagtgaa
cccaggaattggaccagagagagcaaaagcttcaacgtcctgaaacagctgcttctctca
gaaaactgtgtgagagatttgtctcagcacaggagtaactctgtggctgacagtaaaaag
aaaggacacagaaacagtatgaccaacagcaagcctgaattcagcattgcttctctaaac
ggactaatgtgtggtgccactcagcccggcggttgcatggtcagcaggacatttccatac
ccaggtatcggaaaggccccccggagtcctcctttccctgagcacttgggctgcgcaggg
tctagaccagaagctgggcttgtgaatggatgttccatgcccagtgagaagggacccatt
aagtgggttatcacagatgtggacaagaatgagtatgagaaagactctccgagactgacc
aaaactaacccaatactctattacatgctccagaaaggaggcacttctgttaccagtcga
gaaacacaggacagggacatttggagggagccttcatctgctgaaagtatctcacaggtt
acaatcaaagaagagttacttcctgctgcagaaactaaagcttctttctttaatttaagg
agcacttataatagccatatgggaaataatgcttctctcccacagagtgcaaacggagaa
gtttatggacttctgggaaacatgctaacaataaaaaaggaatcagaataa

DBGET integrated database retrieval system