KEGG   Bubalus bubalis (water buffalo): 102394197
Entry
102394197         CDS       T05912                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300 isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04024  cAMP signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04310  Wnt signaling pathway
bbub04330  Notch signaling pathway
bbub04350  TGF-beta signaling pathway
bbub04520  Adherens junction
bbub04630  JAK-STAT signaling pathway
bbub04720  Long-term potentiation
bbub04916  Melanogenesis
bbub04919  Thyroid hormone signaling pathway
bbub04922  Glucagon signaling pathway
bbub04935  Growth hormone synthesis, secretion and action
bbub05016  Huntington disease
bbub05152  Tuberculosis
bbub05161  Hepatitis B
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05206  MicroRNAs in cancer
bbub05211  Renal cell carcinoma
bbub05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102394197 (EP300)
   04330 Notch signaling pathway
    102394197 (EP300)
   04350 TGF-beta signaling pathway
    102394197 (EP300)
   04630 JAK-STAT signaling pathway
    102394197 (EP300)
   04066 HIF-1 signaling pathway
    102394197 (EP300)
   04068 FoxO signaling pathway
    102394197 (EP300)
   04024 cAMP signaling pathway
    102394197 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102394197 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102394197 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102394197 (EP300)
   04935 Growth hormone synthesis, secretion and action
    102394197 (EP300)
   04919 Thyroid hormone signaling pathway
    102394197 (EP300)
   04916 Melanogenesis
    102394197 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    102394197 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102394197 (EP300)
   05206 MicroRNAs in cancer
    102394197 (EP300)
   05203 Viral carcinogenesis
    102394197 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102394197 (EP300)
   05215 Prostate cancer
    102394197 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102394197 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102394197 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102394197 (EP300)
   05161 Hepatitis B
    102394197 (EP300)
   05164 Influenza A
    102394197 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102394197 (EP300)
   05165 Human papillomavirus infection
    102394197 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102394197 (EP300)
   03036 Chromosome and associated proteins [BR:bbub03036]
    102394197 (EP300)
   03029 Mitochondrial biogenesis [BR:bbub03029]
    102394197 (EP300)
Enzymes [BR:bbub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102394197 (EP300)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102394197 (EP300)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102394197 (EP300)
Mitochondrial biogenesis [BR:bbub03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102394197 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102394197
NCBI-ProteinID: XP_006068949
LinkDB
Position
4
AA seq 2412 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGMMSSPVNQPAMGMNTGMNAGMNPGMLT
AGSGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGSAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQMGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPPVQQPGLVAPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQPSNLLSDSMLHSAINS
QNPMMSDNGSVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMVPVMNTGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRVTPQPGLNQFGQVSM
PQPPIGPRQTSPLQHHVQLAQTGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTNM
PLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPAAAIPAPVPTPPAMPPGPQSQVLHPPPRQTPTPPPTQLPPQVQPS
LPAAPSVDQAQQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVNSQTIPEKQPSQEVKMEPKMEVEAPEPADTQPEDIPETKAEDCKVEPTETEERGTEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMSTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPT
GQQPTTPQTPQPPPPSQPQPTPPNNMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEVAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPG
GHLEPGMGPTGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVSQHGQPLNMPPQPGLGQVG
VSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNP
QPLPGQPGLQPPAMPGQQGVHSSPAMQNLNPMQAGVPRAGLPQQPTQQQQLPPPMGGMSP
QAQQMNMNHSTMPSQFRDILRRQQMMQQQQQGAGPGMGPGLANHNQFQPPQGVGYPAPQQ
QPPPRMQHHMQQIPQGSMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQ
QHMLPSQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSP
QTSSPHPGLVAAQGNPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLGTDNSDL
NSNLSQSTLDIH
NT seq 7239 nt   +upstreamnt  +downstreamnt
atggccgagaatgtcgtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctgtttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagctcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaagcccaacaaaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcccaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcccacgccgtctgcaacaggtatgatgagcagtcccgtcaat
cagcctgccatgggaatgaacacggggatgaacgctggcatgaatcctggcatgctgact
gccggcagtggacaagggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgaccgaatatgcagtacccgaacccaggcatgggaagtgctggcaacttaatg
actgagccgctgcagcaaggctctccccagatgggaggacagacgggactgagaggcccc
cagcctctcaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagatgggagccagtggccttggtctccagattccgacaaagtctgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaatatgggccagcagcaggccccaccggtccagcagccaggcctggtggctccggtg
gcccaggggatgggttctggggcacatacggctgatccggagaagcgcaagctcatccag
cagcagcttgtcctcctcctgcacgctcacaagtgccagcgccgggagcaggccaacggg
gaggtgaggcagtgcaaccttccccactgtcgaaccatgaagaacgtcctaaaccacatg
acacactgccagtcgggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcccactggaagaattgtacaaggcatgattgtcctgtgtgtctccccctgaaaaat
gctggagataagagaaatcaacagtcaattttgactggagcaccagttggacttggcaat
actagctctctaggggtgggtcaacagtccactcccagcctaagcactgtcagtcagatt
gatcccagctctatagaaagagcctatgcagcccttggactgccctatcaagtaaatcag
atgccgacccagccccaggtgcaagcgaagaatcagcagaaccagcaatctgggcagtct
ccccaagggatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaccgtcaaatcttctttctgactcaatgttgcattcagccataaattct
caaaacccaatgatgagtgacaatggcagtgtggcctctctgggtcctatgccaacagca
gctcaaccatccagtactggaattcggaagcaatggcatgaagatattactcaggatctt
cgaaatcatcttgtccacaaactcgttcaagccatatttcccactccggatcctgctgct
ttaaaagacagacggatggaaaacctagttgcatatgcccggaaagtggaaggggacatg
tatgaatcggcaaacaatcgagcggaatactaccacctgctagctgagaagatctataag
attcagaaggaactagaagaaaagcgaaggactagactacagaaacagaacatgctacca
agtgctgcaagtatggtgccagttatgaacacagggcctaacatggggcagccacaacca
ggaatgacttctaatggccctctccctgatccatctatgatccgtggcagtgtgccaaac
cagatgatgcctcgggtaactccacaacctggtttgaatcagtttggccaggtgagtatg
cctcagccccctatcggaccccggcaaacctctcctcttcagcaccatgtacagttagcg
caaactggaacacttaacccgcctatgggctacgggcctcgcatgcagcagccttccagc
cagagccagtttcttcctcagactcaattctcaacacagggaatgaatgtaacaaatatg
cctttggctccgtctggcggtcaagcaccagtgtctcaagcacagatgtccagttcttcc
tgtcctgtgaactctcctataatgcctcctgggtctcaagggagccacattcactgtccc
cctctccctcaaccagctctgcatcagaactcaccctcacccgtacctagtcgcaccccc
acccctcaccacactccccctagcataggggctcagcagccaccagcagcagcaatccca
gcccctgttcctacgcctccagccatgccacctggcccacagtcccaggttctccatccg
cctccaagacagacgcctacgccgccaccaacacaacttcctccccaagtgcagccttcg
cttcctgctgctccctcagtggaccaggcgcagcagcagcagcctctgtcccagcaaagc
acagcagcctctgtgcccaccccgacggcacccctgctgcctccgcagccggcaactcca
ctttcccagccagctgtaagcattgaagggcaggtatcaaaccctccatccactagtagc
acggaagtgaattctcagaccattcctgagaagcagccttcacaggaagtaaaaatggag
cctaaaatggaagtggaggcaccagaaccagcagatactcagccggaggatattccagag
actaaagcagaagactgtaaagtagaacctacagaaaccgaagagagaggcactgaatta
aaaactgagacaaaagaagaagaagaccagccaagtacttcagcaacccagtcatctcca
gccccaggacagtcaaagaagaagattttcaaacctgaagagttacgacaggcactgatg
tcaacgttggaggcactttaccgacaggatccggaatcccttccctttcgtcagcctgtg
gaccctcagcttctaggaatccctgattactttgatattgtgaagagccctatggatctt
tctaccatcaagaggaagttagatactggacaatatcaggagccctggcagtatgtggat
gacatttggctcatgttcaacaatgcttggttatataatcggaaaacatcacgggtgtac
aaatactgctccaagctgtctgaggtcttcgaacaagaaattgaccctgtcatgcaaagc
cttggatactgttgtggcagaaagttggagttctctccacagacactctgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttatcagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccaacctcaaactacaataaataaagaacaattttcaaagagaaaaaatgacactctg
gatcctgaactgtttgttgagtgtacagagtgtgggagaaagatgcatcagatctgtgtc
ctccatcatgagatcatctggccatcgggatttgtctgtgatggttgtttaaagaagact
gcacgaactagaaaagaaaataagttttctgctaaaagactgccatctaccaggcttggg
acatttctggagaatcgtgtgaatgagtttctgaggcgacaaaatcaccctgagtcagga
gaggtcactgttcgagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatg
aaagcaagatttgtagatagtggagagatggcagaatcctttccatatcgaaccaaagcg
ctctttgccttcgaagagatcgatggtgttgacttgtgcttctttggtatgcatgttcaa
gagtatggctctgactgccctccgcccaaccagaggagagtatacatatcatacctcgat
agtgttcacttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatcctaatt
ggatatttggaatatgtcaagaaattaggatacacaacagggcatatttgggcgtgtccg
ccaagtgaaggagacgactacatcttccattgccacccccctgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgctcgacaaagctgtgtccgagcgaatc
gtccatgattataaggacattttaaaacaagctactgaagatcgattgacaagcgcgaag
gaattgccttactttgagggtgatttctggcccaacgtcctggaagagagcattaaggaa
ctggaacaggaggaggaggagcggaagcgggaggagaacaccagcaatgagagcacagat
gtgacaaagggagacagcaaaaatgctaaaaagaaaaacaacaagaaaacgagcaaaaac
aagagcagcctgagtcgcggcaataagaagaagccaggcatgcctaacgtatccaacgac
ctctcacagaaattgtatgccaccatggagaagcacaaagaggtcttctttgtgatccgt
ctcatcgctggccctgccgccaactccctgcctcccattgttgaccccgatcccctcatt
ccctgtgacctgatggatgggcgggatgcctttctcacccttgcgagggacaagcacctg
gagttctcgtcgttgcgaagagcccagtggtctaccatgtgcatgctggtggagctgcac
acccagagccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagaca
cgctggcactgcaccgtgtgtgaggattatgacttgtgtatcacctgctacaacactaaa
aaccacgaccacaagatggagaagctcgggctggggcttgatgacgagagcaacaaccag
caggccgccgccacgcagagcccgggagactcccgccgcctgagcatccagcgctgcatc
cagtcgctggtgcatgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccag
aagatgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgc
cccatctgcaaacagctcatcgccctgtgctgctaccatgccaagcactgccaggagaac
aagtgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctgcag
cacaggctccagcaggcccagatgctgcgcaggaggatggccagcatgcagcggactggc
gtggtggggcagcagcagggcctgccctcccctacccctgccaccccgaccacgccaacg
ggccagcagcccaccaccccgcagacaccccagcccccacccccctctcagccccagccc
acacctcccaacaacatgccaccctacttgcccaggactcaagctgctggcccagtgtcc
cagggcaaggcagcaggccaggtgacccccccgacccctcctcagactgctcagccccca
cttccgggacccccacctgcagcagtggaagtggccatgcagattcagagggcagccgag
acgcaacgccagatggcccacgtacaaatctttcagcggccgatccagcaccagatgccg
cagatgactcccatggcccctatgggtatgaacccgccccccatggccagagggcctggt
gggcatttggagccagggatggggcccactggcatgcagcagcaacccccatgggcccag
ggaggactgccccagccccagcagctgcagtccgggatgccccggccagccatgatgtcc
gtgtcacagcacgggcagcccctgaacatgcctccccagccgggcctgggccaggtaggt
gtgagccctctcaagccaggcactgtgtctcaacaagccttacagaacctcctgcggact
ctcaggtctcccagctcccccctgcagcagcaacaggtgctcagtatccttcatgccaac
ccccagctattggctgcgttcatcaaacagcgggctgccaagtacgccaactccaacccg
cagcccctccccgggcagccgggcctgcagccccccgctatgccaggtcagcagggggtc
cactccagccccgccatgcagaacttgaaccccatgcaggcaggtgtcccgagggccggc
ttgccccagcagcccacgcagcagcagcagctcccaccacccatgggcgggatgagccca
caggctcagcagatgaacatgaatcacagcaccatgccctcgcaattccgagacatcttg
aggcgacagcagatgatgcagcagcagcagcagggagcggggccagggatgggcccgggg
ctggccaaccacaaccagttccagcctccccagggcgtgggctaccctgccccacagcag
cagccgccaccgcgaatgcagcatcacatgcagcagataccgcaagggagcatgggacag
atgggccagctcccgcaggccctgggagcagaggcgggagccagtctgcaggcctaccag
cagcggctccttcagcaacagatgggctcgccggcccagcccaaccccatgagcccccag
cagcacatgctcccgagtcaggctcagtccccgcacctccaaggccagcagatcccgtct
ctctccaatcaagtgcgatctccccagcctgtcccttctccgcggcctcagtcccagccc
ccccactccagcccttccccacggatgcagcctcagccttctccacaccacgtctcccca
cagaccagttctccacatcctggactggtcgctgcccagggcaaccccatggaacaaggg
cattttgccagcccggaccagaattcgatgctctctcagctcgctagcaatccaggcatg
gcaaacctccatggtgcgagcgccacggacctgggactcggcaccgacaactcagacttg
aattcaaacctctcacagagtacactagacatacactag

KEGG   Bubalus bubalis (water buffalo): 102403750
Entry
102403750         CDS       T05912                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04024  cAMP signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04310  Wnt signaling pathway
bbub04330  Notch signaling pathway
bbub04350  TGF-beta signaling pathway
bbub04520  Adherens junction
bbub04630  JAK-STAT signaling pathway
bbub04720  Long-term potentiation
bbub04916  Melanogenesis
bbub04919  Thyroid hormone signaling pathway
bbub04922  Glucagon signaling pathway
bbub04935  Growth hormone synthesis, secretion and action
bbub05016  Huntington disease
bbub05152  Tuberculosis
bbub05161  Hepatitis B
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05206  MicroRNAs in cancer
bbub05211  Renal cell carcinoma
bbub05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102403750 (CREBBP)
   04330 Notch signaling pathway
    102403750 (CREBBP)
   04350 TGF-beta signaling pathway
    102403750 (CREBBP)
   04630 JAK-STAT signaling pathway
    102403750 (CREBBP)
   04066 HIF-1 signaling pathway
    102403750 (CREBBP)
   04068 FoxO signaling pathway
    102403750 (CREBBP)
   04024 cAMP signaling pathway
    102403750 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102403750 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102403750 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102403750 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    102403750 (CREBBP)
   04919 Thyroid hormone signaling pathway
    102403750 (CREBBP)
   04916 Melanogenesis
    102403750 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    102403750 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102403750 (CREBBP)
   05206 MicroRNAs in cancer
    102403750 (CREBBP)
   05203 Viral carcinogenesis
    102403750 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102403750 (CREBBP)
   05215 Prostate cancer
    102403750 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102403750 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102403750 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102403750 (CREBBP)
   05161 Hepatitis B
    102403750 (CREBBP)
   05164 Influenza A
    102403750 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102403750 (CREBBP)
   05165 Human papillomavirus infection
    102403750 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102403750 (CREBBP)
   03036 Chromosome and associated proteins [BR:bbub03036]
    102403750 (CREBBP)
   03029 Mitochondrial biogenesis [BR:bbub03029]
    102403750 (CREBBP)
Enzymes [BR:bbub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102403750 (CREBBP)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102403750 (CREBBP)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102403750 (CREBBP)
Mitochondrial biogenesis [BR:bbub03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102403750 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102403750
NCBI-ProteinID: XP_006054927
LinkDB
Position
24
AA seq 2437 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPAQQGLGSQAQGQPSSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQAGGMSKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFAADIKNTSVTNVPNMPQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQIRSLNPLGNNPMNIPAGGITTDQ
QPSNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPAAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMPLPVNRMQVSQG
MNSFNPISLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHA
NSMMAQAPAQSQFLPQSQFPSSSGALSVSSVGMGQPAAQAGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQPPLHQTPPPASTAAGMPSLQHPAAPGVTPPQPAAPTQPSTPASSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPP
GTPLSQTAASIDNRVPTPSSVASAETNSQQPGPEVPLLEMKAEIKTEDTEPDAGEPKGEP
GAAMMEEDLQGSSQVKEETDPTEQKSEPMEVDEKKTEVKVEAKEEEEGSTNGTASQSTSP
SQPRKKIFKPEELRQALMSTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDILKQANEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRTNKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVIHTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HTHKMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPSQPQPSPVSMS
PAGFPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPVSQMAPVGLNVPRPGQVSGPVVPTLPAGQWQQAPIPQQQPMPGMPR
PVMSMQAQPAVAGPRMSSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQAQPGLHQQPGLQNLNAMQASGPRPGVPPQQQAMGG
LNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQGGAGMAGG
MAGHSQFQQPPGPAGYPPTMPQQRMQQHLPMQGSAMGPMAAQMGQLGQMGQPGLGADSTP
NIQQALQQRILQQQQMKQQMGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRS
PAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQ
SAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7314 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagttgatccccaatggaggagaattaagccttttaaacagtgggaacctcgtt
ccagatgctgcttccaaacataaacaactgtccgagctcctgcgaggcggcagcagctcc
agcatcaacccaggaataggcaatgtgagtgccagcagccccgcgcagcaaggcctcggc
agccaggcccaggggcagcccagcagtgccaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttccgcccccagcctgcccaagcaggcagccagcacc
tctgggcccactcctcctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaacgctaac
ttcaaccagacccacccaggcctcctcaatagtaactctggccacagtttaatgaaccag
gcccagcaaggacaggcgcaggtcatgaatggatctcttggggctgctggccgaggaagg
ggagctgggatgccataccctactccggccatgcagggggccacaagcagtgtgctggct
gagaccttgacccaagtttcaccgcaaatggccagtcatgcagggctgaacaccgcacag
gccggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcagatgggagcccctggagtgaaccctcagctgccgagcaag
cagagcatggtcaacagcttgcctccgtttgccgcagacatcaagaacacttcagtcacc
aacgtgccaaacatgcctcagatgcaaacatcagtgggaattgtacccacccaggcaatt
gcaacgggccccactgcagatcccgaaaaacgcaaactgatacagcagcagctggtccta
ctgcttcacgctcataaatgtcagaggcgagaacaagccaacggagaggtccgggcctgc
gcactcccacattgtcgaaccatgaaaaacgtcttgaatcacatgacgcattgtcaggct
gggaaggcttgtcaagttgcccattgcgcatcttcacggcaaatcatctctcattggaag
aactgcacacggcatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacaccattggttctgtt
ggcacaggccaacagaatgccacttctttaagtaacccaaatccgatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagataaggagt
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccatcaaacttgatttcagaatcagctcttccaacttcccttggggctacaaacccc
ctgatgaatgacggctcaaactctggaaacattggcacccttagcactatacctgcagca
gcacctccttccagcaccggcgttcggaaaagctggcacgaacacgtcactcaggacctg
cggagccatctagtgcataaacttgtccaagccatcttcccgacacctgatcctgcagcc
ctgaaggatcgccgcatggagaacctggtggcctacgctaagaaagtggaaggggacatg
tacgagtctgccaacagcagggatgaatactatcacttactagcagagaaaatctacaag
attcaaaaagagctagaagaaaagcggagatcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttaccagcccccgggactcagccccctggaataccccaggcgcagcct
gtgagacctccaaatgggcccatgcctctgccagtgaatcgtatgcaggtttctcaaggg
atgaattcatttaacccaatatccttggggaacgtacagttgccacaagcgcccatggga
ccacgtgcggcatcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccgtcccgaatgcctcagcctccgaacatgatgggcgcgcacgcc
aacagcatgatggcccaggcgcctgcgcagagccagttcctcccacagagccagttcccg
tcgtccagcggggcgctgagtgtgagcagcgtgggcatggggcagccggcggcgcaggct
ggcgttccacaggggcaggtgccaggggccgctcttcccaaccccctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagccgccgctgcatcagaccccg
cctcccgcctccacggccgccggcatgccgtctctgcagcacccagcagctcccggggtg
acgcccccccagccagctgcgcctacccagccgtcaactcccgcgtcgtcttccgggcag
actcccaccccgactcccggctccgtgcccagcgccagccagacgcagagtactcctacg
gtccaggcagccgcccaggcccaggtgaccccgcagcctcagaccccagtgcagcctcca
tccgtggccaccccgcagtcatcgcagcagcagccgacacccgtgcacacgcagccccct
ggcaccccgctttcccagacagcagccagcattgataacagggtccccactccatcctca
gtggccagcgccgaaaccaactcccagcagccaggccccgaggtgccactgctggagatg
aaggccgagatcaagaccgaggacacagagcccgatgctggggagcccaagggagagcct
ggggctgcgatgatggaggaggacttacaaggatcttctcaagttaaagaagaaacagac
ccaacagagcagaagtcagaaccaatggaagtggatgaaaagaaaactgaagtgaaggtc
gaagctaaagaggaagaagagggcagcaccaatgggacagcctctcagtccacgtcccct
tcgcagcctcgcaagaaaatcttcaagccggaggagttgcgccaggctctgatgtcaacc
ctggaagctctgtaccgacaggatccagagtccttaccctttcggcagcctgtggatccc
cagctcctgggaattccagattactttgacattgtgaagaatcccatggacctttccacc
atcaagcggaagctggatacagggcagtaccaggagccctggcagtatgtagacgacgtc
tggctcatgttcaacaacgcctggctttacaatcggaagacatcccgggtctacaagttc
tgcagcaaactcgcagaggtctttgagcaggagattgaccccgtcatgcagtcccttggg
tattgctgtggacgcaagtatgagttttctccacagactctgtgctgctatgggaagcag
ctgtgtacaattcctcgagatgctgcctactacagctatcagaataggtatcacttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaa
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaacctttcgttgactgcaaggagtgtggccggaagatgcatcagatttgtgttctccac
tacgacatcatctggccctcaggttttgtatgtgacaactgcttgaagaaaacgggcaga
actcgaaaagaaaacaaattcagtgctaagagactacagaccacacggttgggaaaccac
ctggaagaccgagtcaacaagtttttgcggcgacagaatcaccctgaagctggggaggtg
tttgtccgtgtggtggccagctcagacaagacagtggaggtcaagccagggatgaagtca
cggtttgtggattctggggagatgtcggagtctttcccgtacagaaccaaagcactcttt
gcctttgaggagattgacggggtggacgtgtgcttctttgggatgcatgtccaggagtac
ggctctgactgccccccgccaaacacaaggcgtgtgtacatatcttatctggacagtatt
catttcttccgaccccgatgcctccgaacagccgtttaccatgagatccttattggatat
ttagagtatgtgaagaaattggggtatgtgacagggcacatctgggcctgtcccccgagt
gaaggagatgactacatcttccactgccacccccctgatcaaaaaatccccaagccgaag
cgcctgcaggagtggtataagaagatgctggacaaggccttcgccgagcgcatcatccat
gactacaaggacattttgaaacaagcaaatgaagacaggctcaccagcgccaaggagctg
ccctactttgagggggacttctggcctaacgtgctggaggagagcattaaggagctggag
caggaggaggaggagaggaagaaggaggagagcaccgcggccagcgagaccacagagggc
agccagggcgacagcaagaacgccaagaaaaagaacaataagaaaaccaacaagaataaa
agcagcatcagccgcaccaacaagaagaagcccagcatgcccaacgtgtccaacgacctg
tcccagaaactctacgccaccatggagaagcacaaagaggtcttctttgtgatccacctc
catgctgggcccgtcatccacacgctgccccccatcgtcgaccctgaccccctgctcagc
tgtgacctcatggatgggcgggatgccttcctcacgctggcccgggacaagcactgggag
ttttcctccttgcggcgctccaagtggtccacgctgtgcatgctggtggagctgcacacc
cagggtcaggaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacacgc
tggcactgcaccgtgtgtgaggactacgacctctgcatcaactgctacaacacgaagagc
cacacccacaagatggtgaagtgggggctgggcctcgacgacgagggcggcagccagggc
gagccgcagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaacgccaactgctcactgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgcccg
gtgtgcaagcagctcatcgccctctgctgctaccacgccaaacactgccaagaaaacaag
tgccccgtgcccttctgcctcaacatcaaacataagctccgccagcagcagatccagcac
cgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagcctgccttcccctacctcagcgccgcccgggacccccacgcagcagccc
agcacgccccagacgccgcagcccccctcccagccccagccctcgcctgtgagcatgtca
ccagccggcttccccagcgtggcccggactcagccacccacgacggtgtccactgggaag
cccaccaaccaggtgcccgccccgccgccccccgcccagcccccacctgcggcggtggag
gcggcccggcagatcgagcgggaggcccagcagcagcagcacctgtaccgggtgaacatc
aacaacggcatgcccccggggcgcacgggcatggtgaccccggtgagccagatggccccc
gtgggcctgaacgttccccggcccggccaggtcagcgggcctgtcgtgcccaccctgccg
gccgggcagtggcagcaggcgcccatcccccagcagcagccgatgccgggcatgccccgg
cccgtgatgtccatgcaggcccagccggctgtggccgggccccggatgtccagtgtgcag
ccgccccggagcatatcgcccggcgccctccaggacctgctgcggaccctgaagtcgccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatg
gcagctttcatcaaacagcgcacggccaagtacgtggccagccagcccggcctgcagcca
cagcccggcctccaggcccagcccggcctgcaccagcagcccggcctgcagaacctgaac
gccatgcaagccagcgggccgcggcctggtgtgcctccacagcagcaggccatgggtggc
ctgaatccccagggccaagccctgaacatcatgaacccgggccacaaccccagcatggcg
agtatgaacccgcagtaccgagagatgctgaggaggcagctcctgcagcagcagcagcag
cagcagcaacagcagcagcagcagcagcagcagcagggcggcgccggcatggccgggggc
atggcagggcacagccagttccagcagcccccgggccccgcaggctacccccccaccatg
ccgcagcagcggatgcagcagcacctccccatgcagggcagcgccatgggcccgatggcg
gctcagatggggcagctcggccagatggggcagcccgggctgggcgcagacagcaccccc
aacatccagcaggccctgcagcagcggattctgcagcagcagcagatgaagcagcagatg
gggtccccgggccagccgaaccccatgagcccccagcagcacatgctctcaggacagcct
caggcctcgcacctccccggccagcagatggccacatccctcagtagccaggtgcggtct
ccggcccctgtccagtctccgcggccccagtcccagcctccacattccagcccgtcgcca
cggatacagccccagccttcaccgcaccacgtctcgccccagactggttccccccaccca
ggactcgcagtcaccatggccagctccatagatcagggacacttggggaaccccgaacag
agtgcaatgctcccgcagctgaacacccctaaccggagtgcgttgtccagtgagctgtcc
ctggtcggcgacaccacgggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system