KEGG   Bubalus bubalis (water buffalo): 102394317
Entry
102394317         CDS       T05912                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04151  PI3K-Akt signaling pathway
bbub04217  Necroptosis
bbub04380  Osteoclast differentiation
bbub04620  Toll-like receptor signaling pathway
bbub04621  NOD-like receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102394317 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    102394317 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102394317 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102394317 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102394317 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    102394317 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    102394317 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102394317 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102394317 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102394317 (IFNAR1)
   05160 Hepatitis C
    102394317 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    102394317 (IFNAR1)
   05164 Influenza A
    102394317 (IFNAR1)
   05162 Measles
    102394317 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    102394317 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102394317 (IFNAR1)
   05169 Epstein-Barr virus infection
    102394317 (IFNAR1)
   05165 Human papillomavirus infection
    102394317 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bbub04050]
    102394317 (IFNAR1)
Cytokine receptors [BR:bbub04050]
 Interleukin receptor families
  IFN receptor family
   102394317 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 CHASE5
Other DBs
NCBI-GeneID: 102394317
NCBI-ProteinID: XP_006048305
LinkDB
Position
1
AA seq 560 aa
MLALLGATTLMLVAGRWVLPAASGEANLKPENVKIHIIDDNFFLKWNSSSESVKNVTFSA
DYQILGTDNWKKLSGCQHITSTKCNFSSVELENVFEKIELRIRAEEGNNTSTWYEVEPFV
PFLEAQIGPPDVHLEAEDKAIILSISPPGTKDSIMWAMDRSSFRYSVVIWKNSSSLEERM
ETVYPEDKIYKLSPEITYCLKVKAELRLQSKVGCYSPVYCINTTERHKVPSPENIQINAD
NQIYVLKWDYPYENATFQAQWLRAFFKKIPGNHSDKWKQIPNCENVTSTHCVFPREVSSR
GIYYVRVRASNGNGTSFWSEEKEFNTEMKTIIFPPVISMKSVTDDSLHVSVGASEESENM
SVNQLYPLIYEVIFWENTSNAERKVLEKRTNFIFPDLKPLTVYCVKARALIENDRRNKGS
SFTDTVCEKTKPGNTSKTWLIVGICTALFSIPVVICVVSVFLRCVKYVFFPSSKPPSSVD
EYFSDQPLRNLLLSTSEEQTERCFIIENSSIITEIEETDEIDEVHKKYSSQTSQDSGNYS
NEDENSGSKISEEFPQQDSV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgctcgctctcctgggcgcgacgaccctgatgctggtcgctgggagatgggtgctgccc
gctgcctcaggggaagcaaatctgaagcctgaaaatgtcaagatccacatcattgatgac
aattttttcctgaagtggaacagcagcagtgagtctgtcaagaatgtgactttttcagca
gattatcaaatactagggacggataactggaagaaattgtctgggtgtcaacatattact
agtaccaaatgcaacttttcttcagtcgagcttgaaaatgtttttgaaaaaattgaattg
cgcataagagcagaagaaggaaacaacacttccacatggtatgaggttgagccatttgta
ccatttctagaagctcagattggtcccccagatgtgcatttagaagctgaagataaggca
ataatactgagtatctctccccctggaacaaaagatagtatcatgtgggctatggatcgt
tcaagctttaggtatagcgtcgttatctggaaaaactcttcaagtctagaagaaagaatg
gaaactgtttatcccgaagataaaatttataaactgtcaccagagattacttactgttta
aaagttaaagcagaactgcgtttacaaagtaaagttggttgctatagtccagtgtattgt
ataaataccacagagagacataaagtgccttcaccagaaaatatacaaatcaatgctgac
aaccagatctatgttcttaagtgggattacccatatgaaaacgcaacttttcaagctcag
tggctccgtgccttttttaaaaagattcctgggaatcattcagacaaatggaaacaaata
ccgaactgtgaaaatgtcacaagtacccactgtgtctttcctcgagaggtttcctcaagg
ggaatttactatgtccgtgtacgagcatctaatggaaatggtacctctttttggtctgaa
gagaaggaatttaatactgaaatgaaaactatcatatttcctccagtcatcagcatgaag
tccgttactgatgattcactgcatgtcagtgtcggtgcttcagaagagtctgaaaacatg
tctgtgaatcagctctacccgctaatttatgaagtaattttttgggaaaacacttcaaat
gctgagagaaaagttctagagaaaagaaccaattttatctttcctgacttgaaaccgctg
actgtgtattgtgtcaaagccagagcactcattgaaaatgacaggcggaataaagggagc
agttttactgatactgtgtgtgagaaaacaaaaccaggaaacacttccaaaacctggctt
atagttggaatttgcactgcattgttttctattcctgtggtcatttgtgttgtgagcgtc
ttcttgagatgtgtcaagtatgtgttctttccatcaagtaaacctccttcctctgttgac
gagtatttctctgatcagccactaaggaatctactcctttccacttctgaggaacaaacg
gaaagatgttttataattgaaaattcaagcattattactgaaatagaagagactgatgaa
attgatgaagttcacaaaaagtacagttcccaaactagtcaagattcaggaaactattca
aacgaagatgaaaacagtggaagcaaaataagtgaagagtttccgcaacaggacagtgtg
tga

DBGET integrated database retrieval system