KEGG   Bubalus bubalis (water buffalo): 102394614Help
Entry
102394614         CDS       T05912                                 

Gene name
PML
Definition
(RefSeq) protein PML isoform X1
  KO
K10054  probable transcription factor PML
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04120  Ubiquitin mediated proteolysis
bbub04144  Endocytosis
bbub05164  Influenza A
bbub05168  Herpes simplex virus 1 infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102394614 (PML)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102394614 (PML)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102394614 (PML)
   05202 Transcriptional misregulation in cancer
    102394614 (PML)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102394614 (PML)
  09172 Infectious disease: viral
   05164 Influenza A
    102394614 (PML)
   05168 Herpes simplex virus 1 infection
    102394614 (PML)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bbub04121]
    102394614 (PML)
Ubiquitin system [BR:bbub04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    102394614 (PML)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3583 zf-B_box Tektin OmpH
Motif
Other DBs
NCBI-GeneID: 102394614
NCBI-ProteinID: XP_006047446
LinkDB All DBs
Position
20
AA seq 871 aa AA seqDB search
MQQDPEPAGSPGPQQDPALPHSPSMPPPESLSEGHQSSHSDSPTEQATEEEFQFLRCQGC
QAEAKCPKLLLCLHTLCSGCLEESSMQCPVCQAPWPSGAGTQALDNVFFESLQRRLSVYQ
QIAREQAFCTRCKELAHYWCFECEQLICAKCFEAHQWFLKHEARPLAELRSQSVREFLDG
TRKSNNIFCSNPNHRSPMLTSIYCRGCSKPLCCSCALLDRGHSELKCDISMEIQQRQDEL
DTMTQDLQEQDRTFGAAQAQMRSAISQLGRVRADTEEFIRERVRDVVAHVLEQERQLLEG
VGARYQRDYEEIAGQLGRLDAVLQRIRMGSVLVQRMKLYASDQEVLDMHDFLRKALHQLR
QEEPQSLRATVRTDSFDEFRVRLQDLVSCISRGTDAALSRRASPEAASTPRDTCGTDPPE
EVPRDQVQAAGLAVVQPVPGAHPVPVYAFSIQDPSLREEGTNTATPQKRKACQTECPRKA
IKMESEEGEESRLARSSPEQPRPSTSRAVSPPHLDGPPSPKSPIIRDELSLPESNHQTGD
PAETEERVVVISSSEDSDAENPDSRELADNSSESSDLQLEGPSSLGVLDDSLSNSLVEDK
PLVFFDLKIDNETQKISQLAAVNQESQFRALIQPEVLNVYSKAVSLEVGLQHFLHFLASM
RQPILACYKLWGPSLPSFFQALEEMNMLGKFQKSISGFLATLPLIRECVPGASSFKLKSL
AKTYLARNMSERSALAAVLTMRDLCRLLEVSPSPQLALHVHPFSSLQCFSSLQPLVRAAV
LPRAEARLLALHKVTFIELLTAHHHDPQGGLKKYNRFLSLQTPTSSQPAFDLQCLGTYFE
GLLGAPALAGAGGVAAPPAGHSLAEGATQQT
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggatccggaacctgccggatctccggggccccagcaggaccccgcactgccc
cactcccccagcatgcctcccccggagtcactctccgaaggccaccagtccagccacagc
gacagccccacagagcaagccacggaggaagagttccagttcttgcgctgccagggctgc
caggcagaagctaagtgccccaagctgctgctttgtctgcacacgctgtgctcaggatgc
ctggaggagtccagcatgcagtgccccgtctgccaggctccctggccctcaggtgccggc
acccaggccctggacaacgtcttcttcgagagcctgcagcggcggctgtcggtgtaccag
cagatcgcacgcgagcaggcgttttgcacccgctgcaaagagctggcccactactggtgc
ttcgagtgcgagcagctcatctgtgccaagtgcttcgaggcgcaccagtggttcctcaag
catgaggcccggccgctggcggagctccgcagccagtcggtgcgggagtttctggacggc
acccgcaagtccaacaacatcttctgctccaaccccaaccaccgcagccctatgctgacc
agcatctactgccgaggctgctccaagcccttgtgctgctcgtgcgcgctcttggatagg
ggccacagcgagctcaagtgtgacatcagcatggagatccagcagcggcaggatgagctg
gacaccatgacccaggacctgcaggagcaggaccgcacctttggggcagcgcaggcgcag
atgcgctctgccatcagccagctgggccgcgtacgcgccgacactgaggagttcatccgt
gagcgcgtgcgcgacgtggtagcgcacgtgctagagcaggagcgtcagctgctggaaggc
gtgggtgcgcggtaccagcgcgactacgaagagatagcgggccagctgggccggctggat
gccgtactgcagcggatccgtatgggcagcgtgctggtgcagaggatgaaactctacgcc
tcggatcaggaggtgctggacatgcatgacttcctgcgcaaggcgctccaccagctgcgc
caggaggagccccagagcctgcgagccaccgtgcgcacagacagcttcgacgaattcagg
gtgcgcctgcaggacctcgtctcttgcatcagccggggtacagatgcagctctatccagg
agagccagcccagaagctgccagcactcccagagacacctgtggcactgacccgccagag
gaggtgccgagggaccaggtgcaagccgcgggattggccgtggtacagccggtgccaggg
gcacaccctgtgccagtgtacgccttctccatccaagacccctccctcagagaagagggc
accaacacggccacaccgcagaagaggaaggcctgccagaccgagtgcccccggaaggcc
atcaagatggagtctgaggagggggaagagtctaggttggctcggagctcccctgagcag
cccaggcccagcacctccagggcagtctcgccaccccacctggatgggccccccagcccc
aagagccccatcataagagatgagctctccctgcctgagagcaaccatcaaaccggcgac
cctgcagagacagaggagcgcgtcgtggtgatcagcagctcggaagactcagatgctgag
aacccggactcccgagagctggccgacaacagcagcgagtccagtgacctccagctggag
ggccccagctccctcggagtcctggacgacagcctctccaactccctggtggaagacaag
cccctggttttctttgacctcaagattgacaatgaaacccagaagattagccagctggca
gccgtgaaccaggaaagccagttccgagcgctcatccagcccgaggtgctcaacgtgtac
tccaaggccgtctccctggaggtgggactgcagcactttctgcatttcctagcgagcatg
cgccagcccatcctggcctgctataagctgtgggggcccagtctccccagcttcttccag
gctctggaggagatgaacatgctggggaagttccagaagtccatctcgggcttcctggcc
accctgcccctcatccgggagtgcgtgccgggggccagcagcttcaaactcaagagcctg
gccaagacctacctggcgagaaacatgagcgaacgcagcgccctggcggccgtgctgacc
atgcgcgacctgtgccgcctgctcgaggtgtcccccagcccccagctggccctgcatgtc
caccccttcagcagcctgcagtgcttctcatccctgcagcccctggtgcgggcggctgtc
ctgcctcgggccgaggcccgcttgctggccctccacaaggtcaccttcatagagctgctg
accgcacaccaccatgacccgcagggcggtctgaagaagtacaaccgattcctgagcctc
cagacccccacatcgtcccagcctgcattcgacctgcagtgtctgggcacctacttcgaa
ggcctgctgggggcgccggccttggcaggggcaggaggcgtcgctgcccctccggctggc
cacagcttggcagaaggggctacgcagcagacctga

DBGET integrated database retrieval system