KEGG   Bubalus bubalis (water buffalo): 102394706
Entry
102394706         CDS       T05912                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01523  Antifolate resistance
bbub04010  MAPK signaling pathway
bbub04014  Ras signaling pathway
bbub04062  Chemokine signaling pathway
bbub04064  NF-kappa B signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04380  Osteoclast differentiation
bbub04620  Toll-like receptor signaling pathway
bbub04621  NOD-like receptor signaling pathway
bbub04622  RIG-I-like receptor signaling pathway
bbub04623  Cytosolic DNA-sensing pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04657  IL-17 signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04668  TNF signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub05132  Salmonella infection
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05145  Toxoplasmosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05212  Pancreatic cancer
bbub05215  Prostate cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05340  Primary immunodeficiency
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102394706 (IKBKG)
   04014 Ras signaling pathway
    102394706 (IKBKG)
   04064 NF-kappa B signaling pathway
    102394706 (IKBKG)
   04668 TNF signaling pathway
    102394706 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102394706 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102394706 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102394706 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102394706 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102394706 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102394706 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102394706 (IKBKG)
   04660 T cell receptor signaling pathway
    102394706 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102394706 (IKBKG)
   04659 Th17 cell differentiation
    102394706 (IKBKG)
   04657 IL-17 signaling pathway
    102394706 (IKBKG)
   04662 B cell receptor signaling pathway
    102394706 (IKBKG)
   04062 Chemokine signaling pathway
    102394706 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102394706 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102394706 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102394706 (IKBKG)
   05203 Viral carcinogenesis
    102394706 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102394706 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102394706 (IKBKG)
   05221 Acute myeloid leukemia
    102394706 (IKBKG)
   05220 Chronic myeloid leukemia
    102394706 (IKBKG)
   05215 Prostate cancer
    102394706 (IKBKG)
   05222 Small cell lung cancer
    102394706 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102394706 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102394706 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102394706 (IKBKG)
   05135 Yersinia infection
    102394706 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102394706 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102394706 (IKBKG)
   05162 Measles
    102394706 (IKBKG)
   05164 Influenza A
    102394706 (IKBKG)
   05161 Hepatitis B
    102394706 (IKBKG)
   05160 Hepatitis C
    102394706 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102394706 (IKBKG)
   05163 Human cytomegalovirus infection
    102394706 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102394706 (IKBKG)
   05169 Epstein-Barr virus infection
    102394706 (IKBKG)
   05165 Human papillomavirus infection
    102394706 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102394706 (IKBKG)
   05142 Chagas disease
    102394706 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102394706 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102394706 (IKBKG)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102394706 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO LLC1
Other DBs
NCBI-GeneID: 102394706
NCBI-ProteinID: XP_025131849
LinkDB
Position
X
AA seq 603 aa
MFGKHPSGMDCFPCLPLCLPCGGGSPTRQSRRASQLQDRGLHSMATHGLQKCLTALTCWM
SRPPWKSPLCEMVQPSGGPAGDQDMLGEESSLGKPAMLHVPSEQGTPETFQRCLEENQEL
RAISADAIRQSNQMLRERCEELQRFQGNQREEKAFLMQKFQEARDLVVRLSLEKRELRQQ
REQALKEVERLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRARVA
SEKARQLESEREALEQRHSVQVDQLVLQNESMEAALRMERQAASEEKRKLAQLQVAYHQL
FQEYDNHMKSSMVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMET
VPVLKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMR
KRHVEVSQPPLAPGPGWNPWTSARIGNEFAEKPRVHSSQVRREQGTVCLGLSMQVPLLCP
FFRGEPPPPPQRGVCVSAAGCRHSRYYRILGGAEHRACGRSGASGSGETQGWSCSVNSAG
SIASECCGSGPRWGLISQNHLDVCSTRMRIQSASRSVTEQAWASLSVGSSSQNFLLKITT
NDR
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgtttggaaaacacccttctggaatggactgcttcccctgtttacctctctgtcttccc
tgtggaggaggaagtccaaccagacagtcccgaagggcctcccagctccaggacagaggt
ctacactcaatggctacacacggacttcagaaatgcctcacggccctgacgtgttggatg
agcaggcccccctggaagagtccactgtgtgagatggtgcagccgagtggcggtccggca
ggggaccaggacatgctgggtgaagagtcttctctggggaagccagccatgctccatgtg
ccttcagagcagggcacccctgagaccttccagcgctgtctggaggagaatcaagagctc
cgagccatctctgcagacgccattcgccagagcaaccagatgctgcgcgagcgctgtgag
gagctgcagcgtttccagggcaaccagagggaggagaaggccttcctcatgcagaagttc
caggaggcccgggacttggtggtgaggctgagcctagagaagcgtgaactgcgccagcag
agggagcaggccctgaaggaggtggagcgcctgaagacgtgccagcagcagatggctgag
gacaaggcctcagtgaaagcccaggtaacgtccttgctgggggagctgcaggagagccag
agtcgcttggaggctgccactaaggagcgccaggctttggagagcagggcccgggtggcc
agcgaaaaggcccggcagctggagagcgagcgggaggcactggaacagcggcacagcgtg
caggtggaccagcttgttctgcagaacgagagcatggaagctgccctgcgcatggaacgc
caggccgcctcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctc
ttccaagagtatgacaatcacatgaagagcagcatggtgagcagtgagcggaaccgagga
ctgcagctggaggatctcaagcagcagctccagcaggctgaggaggccctggtggccaaa
caggaagtgatcgacaagctgaaggaggaggcggaacagcacaagatcgtgatggagact
gtcccagtgctaaaagcccaggcggatatctacaaggcagacttccaggccgagaggcag
gcccgggagaagctggctgagaagaaggaatttctacaagaacagctggagcagctgcag
agggaatacagcaggctcaagaccagctgtcaggagtcagccaggattgaagacatgagg
aagcggcacgttgaggtctcccagccccccttagcccctggcccagggtggaacccctgg
accagcgcgaggataggcaatgagtttgctgagaagccccgtgtgcactcatcgcaggtc
agaagagaacaggggactgtctgccttggtctctcgatgcaggtgcccctgctctgtcct
ttctttagaggagaaccccccccccccccacagagaggggtgtgcgtgtcagcggcgggg
tgcaggcacagccgatactatcgcatcctgggtggagcagagcacagggcatgtggtagg
tctggtgcgtctggaagcggggagacccagggatggagctgttctgtgaattctgcaggt
tccattgcgtctgagtgttgtgggtctgggccgaggtggggattgatctctcagaatcac
ttagatgtctgcagtaccagaatgaggattcagtcagcatccaggagtgtgacagaacaa
gcctgggcttctctaagcgtgggcagtagtagtcaaaattttctgttgaaaataactaca
aatgacagatga

DBGET integrated database retrieval system