KEGG   Bubalus bubalis (water buffalo): 102395384
Entry
102395384         CDS       T05912                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04070  Phosphatidylinositol signaling system
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04613  Neutrophil extracellular trap formation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04670  Leukocyte transendothelial migration
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04960  Aldosterone-regulated sodium reabsorption
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05100  Bacterial invasion of epithelial cells
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05146  Amoebiasis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102395384
   04014 Ras signaling pathway
    102395384
   04015 Rap1 signaling pathway
    102395384
   04370 VEGF signaling pathway
    102395384
   04630 JAK-STAT signaling pathway
    102395384
   04668 TNF signaling pathway
    102395384
   04066 HIF-1 signaling pathway
    102395384
   04068 FoxO signaling pathway
    102395384
   04070 Phosphatidylinositol signaling system
    102395384
   04072 Phospholipase D signaling pathway
    102395384
   04071 Sphingolipid signaling pathway
    102395384
   04024 cAMP signaling pathway
    102395384
   04151 PI3K-Akt signaling pathway
    102395384
   04152 AMPK signaling pathway
    102395384
   04150 mTOR signaling pathway
    102395384
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102395384
  09143 Cell growth and death
   04210 Apoptosis
    102395384
   04218 Cellular senescence
    102395384
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102395384
   04550 Signaling pathways regulating pluripotency of stem cells
    102395384
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102395384
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102395384
   04613 Neutrophil extracellular trap formation
    102395384
   04620 Toll-like receptor signaling pathway
    102395384
   04625 C-type lectin receptor signaling pathway
    102395384
   04650 Natural killer cell mediated cytotoxicity
    102395384
   04660 T cell receptor signaling pathway
    102395384
   04662 B cell receptor signaling pathway
    102395384
   04664 Fc epsilon RI signaling pathway
    102395384
   04666 Fc gamma R-mediated phagocytosis
    102395384
   04670 Leukocyte transendothelial migration
    102395384
   04062 Chemokine signaling pathway
    102395384
  09152 Endocrine system
   04910 Insulin signaling pathway
    102395384
   04923 Regulation of lipolysis in adipocytes
    102395384
   04929 GnRH secretion
    102395384
   04915 Estrogen signaling pathway
    102395384
   04914 Progesterone-mediated oocyte maturation
    102395384
   04917 Prolactin signaling pathway
    102395384
   04926 Relaxin signaling pathway
    102395384
   04935 Growth hormone synthesis, secretion and action
    102395384
   04919 Thyroid hormone signaling pathway
    102395384
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102395384
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102395384
  09156 Nervous system
   04725 Cholinergic synapse
    102395384
   04722 Neurotrophin signaling pathway
    102395384
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102395384
  09158 Development and regeneration
   04360 Axon guidance
    102395384
   04380 Osteoclast differentiation
    102395384
  09149 Aging
   04211 Longevity regulating pathway
    102395384
   04213 Longevity regulating pathway - multiple species
    102395384
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102395384
   05206 MicroRNAs in cancer
    102395384
   05205 Proteoglycans in cancer
    102395384
   05203 Viral carcinogenesis
    102395384
   05230 Central carbon metabolism in cancer
    102395384
   05231 Choline metabolism in cancer
    102395384
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102395384
  09162 Cancer: specific types
   05210 Colorectal cancer
    102395384
   05212 Pancreatic cancer
    102395384
   05225 Hepatocellular carcinoma
    102395384
   05226 Gastric cancer
    102395384
   05214 Glioma
    102395384
   05221 Acute myeloid leukemia
    102395384
   05220 Chronic myeloid leukemia
    102395384
   05218 Melanoma
    102395384
   05211 Renal cell carcinoma
    102395384
   05215 Prostate cancer
    102395384
   05213 Endometrial cancer
    102395384
   05224 Breast cancer
    102395384
   05222 Small cell lung cancer
    102395384
   05223 Non-small cell lung cancer
    102395384
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102395384
   05017 Spinocerebellar ataxia
    102395384
   05020 Prion disease
    102395384
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102395384
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102395384
   04932 Non-alcoholic fatty liver disease
    102395384
   04931 Insulin resistance
    102395384
   04933 AGE-RAGE signaling pathway in diabetic complications
    102395384
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102395384
   05100 Bacterial invasion of epithelial cells
    102395384
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102395384
   05170 Human immunodeficiency virus 1 infection
    102395384
   05161 Hepatitis B
    102395384
   05160 Hepatitis C
    102395384
   05171 Coronavirus disease - COVID-19
    102395384
   05164 Influenza A
    102395384
   05162 Measles
    102395384
   05168 Herpes simplex virus 1 infection
    102395384
   05163 Human cytomegalovirus infection
    102395384
   05167 Kaposi sarcoma-associated herpesvirus infection
    102395384
   05169 Epstein-Barr virus infection
    102395384
   05165 Human papillomavirus infection
    102395384
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102395384
   05142 Chagas disease
    102395384
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102395384
   01524 Platinum drug resistance
    102395384
   01522 Endocrine resistance
    102395384
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102395384
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102395384
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 Cupin_8 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 102395384
NCBI-ProteinID: XP_006052598
LinkDB
Position
6
AA seq 467 aa
MGSIDGTEERSATHSQCHLERRVAQMFSTPHPVLEERHPTKTLPPKPPKPMTSAITNGIK
DSSVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIK
IYHRDGKYGFSDPLTFNSVVELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNI
DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQE
QHSKEYIERFRKEGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKK
MNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYD
EKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYG
FAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgggttcgattgatggcacggaagaaaggagtgccactcattcacagtgccaccttgaa
agaagggtggcacagatgttctctaccccccaccctgtcctagaggaaaggcatccaaca
aaaactcttccaccaaagccacctaagccaatgacttcagccattacaaatggaataaag
gacagttctgtttctcttcaggatgcagaatggtactggggggatatttcaagggaggag
gtaaatgacaaattgcgggacatgccagatggtaccttcttggtcagagatgcctcaacc
aaaatgcagggagattacactttgaccttgcggaagggaggcaataataagctaataaag
atttatcatcgagatggtaaatatggcttttctgatcctctgacatttaattctgtggtg
gagctcattagccactatcatcatgaatctcttgcccagtacaatcccaaacttgatgtg
aaactgatgtacccagtgtccagataccaacaggatcagttggtaaaagaagataatatt
gatgctgtcggtaaaaaactgcaggagtatcactctcagtatcaggaaaagagtaaagaa
tatgacagactatatgaagaatataccagaacatcccaggaaatacagatgaagaggact
gcaattgaagcttttaatgaaacaattaaaatatttgaagagcagtgtcatacacaagaa
caacatagcaaagaatatattgagcgatttcgaaaagaagggaatgaaaaggaaattgaa
cgaattatgatgaattatgacaagttgaaatcacgtctgggtgagattcatgatagcaaa
atgcgtcttgaacaggatttgaagaaacaagctttggataaccgagaaatagataaaaaa
atgaatagtatcaaacctgacctgatccagctgcgcaagatccgagatcagcaccttgtg
tggctcaatcacaaaggagtgagacagaagcgcctaaatgcctggctgggaatcaagaat
gaggatgctgatgagacctattttatcaatgaggaagatgaaaacctgccccattatgat
gagaaaacctggtttgttgaggatatcaaccgagtacaagcagaggacttgctttatggg
aaacctgacggtgcattcttaatccgtgagagtagcaagaaaggatgttatgcttgctct
gtggtcgccgatggagaggtgaagcactgtgtcatctacagcactgctcggggctacggc
ttcgcagagccctacaacctgtacagctccctgaaggagctggtgctccactaccagcag
acgtccctcgtgcagcacaacgactctctcaacgtcaggctcgcctaccctgtccacgca
cagatgccctcgctctgcagataa

KEGG   Bubalus bubalis (water buffalo): 102400519
Entry
102400519         CDS       T05912                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00562  Inositol phosphate metabolism
bbub01100  Metabolic pathways
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04070  Phosphatidylinositol signaling system
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04613  Neutrophil extracellular trap formation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04670  Leukocyte transendothelial migration
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04960  Aldosterone-regulated sodium reabsorption
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05100  Bacterial invasion of epithelial cells
bbub05132  Salmonella infection
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05146  Amoebiasis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102400519 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102400519 (PIK3CA)
   04014 Ras signaling pathway
    102400519 (PIK3CA)
   04015 Rap1 signaling pathway
    102400519 (PIK3CA)
   04370 VEGF signaling pathway
    102400519 (PIK3CA)
   04630 JAK-STAT signaling pathway
    102400519 (PIK3CA)
   04668 TNF signaling pathway
    102400519 (PIK3CA)
   04066 HIF-1 signaling pathway
    102400519 (PIK3CA)
   04068 FoxO signaling pathway
    102400519 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102400519 (PIK3CA)
   04072 Phospholipase D signaling pathway
    102400519 (PIK3CA)
   04071 Sphingolipid signaling pathway
    102400519 (PIK3CA)
   04024 cAMP signaling pathway
    102400519 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    102400519 (PIK3CA)
   04152 AMPK signaling pathway
    102400519 (PIK3CA)
   04150 mTOR signaling pathway
    102400519 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102400519 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    102400519 (PIK3CA)
   04218 Cellular senescence
    102400519 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102400519 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    102400519 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102400519 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102400519 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    102400519 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    102400519 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102400519 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    102400519 (PIK3CA)
   04660 T cell receptor signaling pathway
    102400519 (PIK3CA)
   04662 B cell receptor signaling pathway
    102400519 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    102400519 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    102400519 (PIK3CA)
   04670 Leukocyte transendothelial migration
    102400519 (PIK3CA)
   04062 Chemokine signaling pathway
    102400519 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102400519 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    102400519 (PIK3CA)
   04929 GnRH secretion
    102400519 (PIK3CA)
   04915 Estrogen signaling pathway
    102400519 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102400519 (PIK3CA)
   04917 Prolactin signaling pathway
    102400519 (PIK3CA)
   04926 Relaxin signaling pathway
    102400519 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    102400519 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    102400519 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102400519 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102400519 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    102400519 (PIK3CA)
   04722 Neurotrophin signaling pathway
    102400519 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102400519 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102400519 (PIK3CA)
   04380 Osteoclast differentiation
    102400519 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    102400519 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    102400519 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102400519 (PIK3CA)
   05206 MicroRNAs in cancer
    102400519 (PIK3CA)
   05205 Proteoglycans in cancer
    102400519 (PIK3CA)
   05203 Viral carcinogenesis
    102400519 (PIK3CA)
   05230 Central carbon metabolism in cancer
    102400519 (PIK3CA)
   05231 Choline metabolism in cancer
    102400519 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102400519 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102400519 (PIK3CA)
   05212 Pancreatic cancer
    102400519 (PIK3CA)
   05225 Hepatocellular carcinoma
    102400519 (PIK3CA)
   05226 Gastric cancer
    102400519 (PIK3CA)
   05214 Glioma
    102400519 (PIK3CA)
   05221 Acute myeloid leukemia
    102400519 (PIK3CA)
   05220 Chronic myeloid leukemia
    102400519 (PIK3CA)
   05218 Melanoma
    102400519 (PIK3CA)
   05211 Renal cell carcinoma
    102400519 (PIK3CA)
   05215 Prostate cancer
    102400519 (PIK3CA)
   05213 Endometrial cancer
    102400519 (PIK3CA)
   05224 Breast cancer
    102400519 (PIK3CA)
   05222 Small cell lung cancer
    102400519 (PIK3CA)
   05223 Non-small cell lung cancer
    102400519 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102400519 (PIK3CA)
   05017 Spinocerebellar ataxia
    102400519 (PIK3CA)
   05020 Prion disease
    102400519 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102400519 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102400519 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    102400519 (PIK3CA)
   04931 Insulin resistance
    102400519 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102400519 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102400519 (PIK3CA)
   05135 Yersinia infection
    102400519 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    102400519 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102400519 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    102400519 (PIK3CA)
   05161 Hepatitis B
    102400519 (PIK3CA)
   05160 Hepatitis C
    102400519 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    102400519 (PIK3CA)
   05164 Influenza A
    102400519 (PIK3CA)
   05162 Measles
    102400519 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    102400519 (PIK3CA)
   05163 Human cytomegalovirus infection
    102400519 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102400519 (PIK3CA)
   05169 Epstein-Barr virus infection
    102400519 (PIK3CA)
   05165 Human papillomavirus infection
    102400519 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102400519 (PIK3CA)
   05142 Chagas disease
    102400519 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102400519 (PIK3CA)
   01524 Platinum drug resistance
    102400519 (PIK3CA)
   01522 Endocrine resistance
    102400519 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102400519 (PIK3CA)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102400519 (PIK3CA)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102400519 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 102400519
NCBI-ProteinID: XP_006054362
LinkDB
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acgttaataacgataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcgtcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaattcgatatggttaaagatccagaagtacaggacttccga
aggaatattctcaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtttatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaaacagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctattctcaactgccaatggac
tgttttacaatgccatcatattccagacgcatctccacagctacgccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatttatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgtgaagcaggatttagttattctcatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaactctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaagcctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaggttttgctgttcggtgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtactaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcgttaactaat
caaaggatcggtcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatctgaag
caccttaataggcaagttgaggctatggaaaagctcattaacttgactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgcgg
cgaccagatttcatggatgctctccagggctttctgtctcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcttctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacccttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggatgtctgtca
attggtgactgtgtgggacttatcgaggtggtgagaaattctcacactataatgcagatt
cagtgtaaaggaggcctgaaaggtgcactgcagttcaacagccacacactccatcagtgg
ctcaaagacaagaacaagggagagatatatgatgcagccatcgatttgtttacacgatca
tgtgctggatattgtgttgccaccttcattttgggaattggagatcgtcacaatagtaat
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagagcgcgtgccgtttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Bubalus bubalis (water buffalo): 102404165
Entry
102404165         CDS       T05912                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00562  Inositol phosphate metabolism
bbub01100  Metabolic pathways
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04070  Phosphatidylinositol signaling system
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04613  Neutrophil extracellular trap formation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04670  Leukocyte transendothelial migration
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04960  Aldosterone-regulated sodium reabsorption
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05100  Bacterial invasion of epithelial cells
bbub05132  Salmonella infection
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05146  Amoebiasis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102404165 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102404165 (PIK3CB)
   04014 Ras signaling pathway
    102404165 (PIK3CB)
   04015 Rap1 signaling pathway
    102404165 (PIK3CB)
   04370 VEGF signaling pathway
    102404165 (PIK3CB)
   04630 JAK-STAT signaling pathway
    102404165 (PIK3CB)
   04668 TNF signaling pathway
    102404165 (PIK3CB)
   04066 HIF-1 signaling pathway
    102404165 (PIK3CB)
   04068 FoxO signaling pathway
    102404165 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102404165 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102404165 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102404165 (PIK3CB)
   04024 cAMP signaling pathway
    102404165 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102404165 (PIK3CB)
   04152 AMPK signaling pathway
    102404165 (PIK3CB)
   04150 mTOR signaling pathway
    102404165 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102404165 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    102404165 (PIK3CB)
   04218 Cellular senescence
    102404165 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102404165 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102404165 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102404165 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102404165 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    102404165 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102404165 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102404165 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102404165 (PIK3CB)
   04660 T cell receptor signaling pathway
    102404165 (PIK3CB)
   04662 B cell receptor signaling pathway
    102404165 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102404165 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102404165 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102404165 (PIK3CB)
   04062 Chemokine signaling pathway
    102404165 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102404165 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    102404165 (PIK3CB)
   04929 GnRH secretion
    102404165 (PIK3CB)
   04915 Estrogen signaling pathway
    102404165 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102404165 (PIK3CB)
   04917 Prolactin signaling pathway
    102404165 (PIK3CB)
   04926 Relaxin signaling pathway
    102404165 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    102404165 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102404165 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102404165 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102404165 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    102404165 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102404165 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102404165 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102404165 (PIK3CB)
   04380 Osteoclast differentiation
    102404165 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    102404165 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102404165 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102404165 (PIK3CB)
   05206 MicroRNAs in cancer
    102404165 (PIK3CB)
   05205 Proteoglycans in cancer
    102404165 (PIK3CB)
   05203 Viral carcinogenesis
    102404165 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102404165 (PIK3CB)
   05231 Choline metabolism in cancer
    102404165 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102404165 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102404165 (PIK3CB)
   05212 Pancreatic cancer
    102404165 (PIK3CB)
   05225 Hepatocellular carcinoma
    102404165 (PIK3CB)
   05226 Gastric cancer
    102404165 (PIK3CB)
   05214 Glioma
    102404165 (PIK3CB)
   05221 Acute myeloid leukemia
    102404165 (PIK3CB)
   05220 Chronic myeloid leukemia
    102404165 (PIK3CB)
   05218 Melanoma
    102404165 (PIK3CB)
   05211 Renal cell carcinoma
    102404165 (PIK3CB)
   05215 Prostate cancer
    102404165 (PIK3CB)
   05213 Endometrial cancer
    102404165 (PIK3CB)
   05224 Breast cancer
    102404165 (PIK3CB)
   05222 Small cell lung cancer
    102404165 (PIK3CB)
   05223 Non-small cell lung cancer
    102404165 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102404165 (PIK3CB)
   05017 Spinocerebellar ataxia
    102404165 (PIK3CB)
   05020 Prion disease
    102404165 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102404165 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102404165 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    102404165 (PIK3CB)
   04931 Insulin resistance
    102404165 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102404165 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102404165 (PIK3CB)
   05135 Yersinia infection
    102404165 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    102404165 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102404165 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    102404165 (PIK3CB)
   05161 Hepatitis B
    102404165 (PIK3CB)
   05160 Hepatitis C
    102404165 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    102404165 (PIK3CB)
   05164 Influenza A
    102404165 (PIK3CB)
   05162 Measles
    102404165 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    102404165 (PIK3CB)
   05163 Human cytomegalovirus infection
    102404165 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102404165 (PIK3CB)
   05169 Epstein-Barr virus infection
    102404165 (PIK3CB)
   05165 Human papillomavirus infection
    102404165 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102404165 (PIK3CB)
   05142 Chagas disease
    102404165 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102404165 (PIK3CB)
   01524 Platinum drug resistance
    102404165 (PIK3CB)
   01522 Endocrine resistance
    102404165 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102404165 (PIK3CB)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102404165 (PIK3CB)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102404165 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 102404165
NCBI-ProteinID: XP_006070036
LinkDB
Position
1
AA seq 1070 aa
MCFYFMMPPAMADVLDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISCIKQMLW
KQVTNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKHTYPPEL
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPIMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHSLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMVAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEPLEFDINTCDLPRMTRLCFAVYAVLDKVKTKKSTKTM
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPHALPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKTEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttctacttcatgatgcctcctgctatggcagacgtccttgacatctgggcagtg
gactcacagatagcatctgatggctccatacccgtggattttcttttgcccactgggatt
tatatccagttggaggtgcctcgtgaagctaccatttcctgtattaagcagatgttatgg
aaacaagttaccaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagctcgaagatgaaacaagaagactttgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcagattcagtgaggaaaagatt
cagtcgcttgtgggattatcttggatggattggctaaagcatacctatccacctgagctt
gaaccatccatccctgaaaatttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagttttcaggtatctcctattatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtctgactattcatgggaaagaagatgaa
gttagcccttatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cactcactaattcagttccagtatatccggaactgtgtaatgaacagaacattgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtatgaacaggaaatggttgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaatcctttccaaattgtcttggttaaagga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggccggcctttttcatggt
accgaactcctgtgtaaaactgttgtaagctcagagatatcagggaagaatgatcatatt
tggaatgaaccactggaatttgatatcaacacttgtgacctgccacgaatgactcgatta
tgttttgctgtttatgcagttttggataaagtgaaaactaagaaatcaactaaaaccatg
aatccctctaagtatcagaccatcaggaaatctggaaaagtgcattatcctgtagcctgg
gtaaatacaatggtttttgactttaaaggacagttgagatctggagatataatattacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatacagaaaatgcaacagctttgcacataaaattcccagagaataaaaaa
caaccgtattactatcctcccttcgataagattattgaaaaagcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatcctttgtctcaactatgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacatgcattgccaaaattgctgctgtcgatc
aagtggaataaacttgaggatgttgctcagcttcaagcactgcttcagatttggcctaaa
ctgcccccccgggaggcccttgagcttctagatttcaactatccagatcagtatgtgcga
gaatatgctgtgggctgcctgcaacagatgagtgatgaagaactctctcagtatctttta
cagttggtgcaagttttaaaatatgagccttttcttgattgtgccttgtctagattccta
ctcgaaagagcacttgctaatcggaggatagggcagtttttattttggcacctcagatct
gaagtacacattcctgctgtttcagtacaatttggtgttatccttgaagcgtactgccgg
ggaagcgtaggtcacatgaaggcgctttctaagcaggttgaagcactcaataaactaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaatagagccaaagggaaagaa
gcaatgcacacttgtttaaaacagaatgcttatcgtgaagccctctctgacctgcagtca
cctctcaacccatgtgttatcctctcagaactctatgttgagaagtgtaaatacatggat
tccaaaatgaagcctttgtggcttgtgtacaacaacaaggtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggaccttcggatgctaccttacggc
tgcttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgttgctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctatcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acttatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaaatttggc
cggttccgccagtgttgtgaggatgcgtatctgattttacgccggcatgggaatctcttc
atcacgctctttgcactgatgttgactgcagggcttcctgagctcacctcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagactgaagaagaagcactcaagcaa
ttcaagcaaaaatttgatgaggcactcagggaaagttggactactaaagtcaattggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Bubalus bubalis (water buffalo): 102404517
Entry
102404517         CDS       T05912                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04070  Phosphatidylinositol signaling system
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04613  Neutrophil extracellular trap formation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04670  Leukocyte transendothelial migration
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04960  Aldosterone-regulated sodium reabsorption
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05100  Bacterial invasion of epithelial cells
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05146  Amoebiasis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102404517 (PIK3R2)
   04014 Ras signaling pathway
    102404517 (PIK3R2)
   04015 Rap1 signaling pathway
    102404517 (PIK3R2)
   04370 VEGF signaling pathway
    102404517 (PIK3R2)
   04630 JAK-STAT signaling pathway
    102404517 (PIK3R2)
   04668 TNF signaling pathway
    102404517 (PIK3R2)
   04066 HIF-1 signaling pathway
    102404517 (PIK3R2)
   04068 FoxO signaling pathway
    102404517 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    102404517 (PIK3R2)
   04072 Phospholipase D signaling pathway
    102404517 (PIK3R2)
   04071 Sphingolipid signaling pathway
    102404517 (PIK3R2)
   04024 cAMP signaling pathway
    102404517 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    102404517 (PIK3R2)
   04152 AMPK signaling pathway
    102404517 (PIK3R2)
   04150 mTOR signaling pathway
    102404517 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102404517 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    102404517 (PIK3R2)
   04218 Cellular senescence
    102404517 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102404517 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102404517 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102404517 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102404517 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    102404517 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    102404517 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    102404517 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    102404517 (PIK3R2)
   04660 T cell receptor signaling pathway
    102404517 (PIK3R2)
   04662 B cell receptor signaling pathway
    102404517 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    102404517 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    102404517 (PIK3R2)
   04670 Leukocyte transendothelial migration
    102404517 (PIK3R2)
   04062 Chemokine signaling pathway
    102404517 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102404517 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    102404517 (PIK3R2)
   04929 GnRH secretion
    102404517 (PIK3R2)
   04915 Estrogen signaling pathway
    102404517 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    102404517 (PIK3R2)
   04917 Prolactin signaling pathway
    102404517 (PIK3R2)
   04926 Relaxin signaling pathway
    102404517 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    102404517 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    102404517 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102404517 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102404517 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    102404517 (PIK3R2)
   04722 Neurotrophin signaling pathway
    102404517 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102404517 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102404517 (PIK3R2)
   04380 Osteoclast differentiation
    102404517 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    102404517 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    102404517 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102404517 (PIK3R2)
   05206 MicroRNAs in cancer
    102404517 (PIK3R2)
   05205 Proteoglycans in cancer
    102404517 (PIK3R2)
   05203 Viral carcinogenesis
    102404517 (PIK3R2)
   05230 Central carbon metabolism in cancer
    102404517 (PIK3R2)
   05231 Choline metabolism in cancer
    102404517 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102404517 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102404517 (PIK3R2)
   05212 Pancreatic cancer
    102404517 (PIK3R2)
   05225 Hepatocellular carcinoma
    102404517 (PIK3R2)
   05226 Gastric cancer
    102404517 (PIK3R2)
   05214 Glioma
    102404517 (PIK3R2)
   05221 Acute myeloid leukemia
    102404517 (PIK3R2)
   05220 Chronic myeloid leukemia
    102404517 (PIK3R2)
   05218 Melanoma
    102404517 (PIK3R2)
   05211 Renal cell carcinoma
    102404517 (PIK3R2)
   05215 Prostate cancer
    102404517 (PIK3R2)
   05213 Endometrial cancer
    102404517 (PIK3R2)
   05224 Breast cancer
    102404517 (PIK3R2)
   05222 Small cell lung cancer
    102404517 (PIK3R2)
   05223 Non-small cell lung cancer
    102404517 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102404517 (PIK3R2)
   05017 Spinocerebellar ataxia
    102404517 (PIK3R2)
   05020 Prion disease
    102404517 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102404517 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102404517 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    102404517 (PIK3R2)
   04931 Insulin resistance
    102404517 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102404517 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102404517 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    102404517 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102404517 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    102404517 (PIK3R2)
   05161 Hepatitis B
    102404517 (PIK3R2)
   05160 Hepatitis C
    102404517 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    102404517 (PIK3R2)
   05164 Influenza A
    102404517 (PIK3R2)
   05162 Measles
    102404517 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    102404517 (PIK3R2)
   05163 Human cytomegalovirus infection
    102404517 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102404517 (PIK3R2)
   05169 Epstein-Barr virus infection
    102404517 (PIK3R2)
   05165 Human papillomavirus infection
    102404517 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102404517 (PIK3R2)
   05142 Chagas disease
    102404517 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102404517 (PIK3R2)
   01524 Platinum drug resistance
    102404517 (PIK3R2)
   01522 Endocrine resistance
    102404517 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102404517 (PIK3R2)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102404517 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 102404517
NCBI-ProteinID: XP_006057992
LinkDB
Position
9
AA seq 724 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSYRPEPPAVRTDWSLSDVEQWDAAALSDGVKGFLLALPA
PLVTPEAAAEAHRALREAAGPVGPALEPPTLPLHHALTLRFLLQHLGRVAGRAPAPGPAV
RALGATFGPLLLRAPPPPSPPPGGAPDGTEPTPDFPALLVEKLLQEHLEEQEVAPPALPP
KPPKTKPAPTGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGE
YTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYP
VSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAF
NETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQ
ELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQ
YSLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGD
TKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPP
PAAR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggctggccctgagggcttccaataccgtgcattgtacccattccgccgggagcggccg
gaggacctggagctgcttccgggtgatgtgctggtggtgagcagggccgccctgcaggcg
ctgggcgtggccgagggcaatgagcgctgcccgcagagtgtaggctggatgcctggcctc
aatgagcgtacccggcagcgtggcgacttccctggcacctatgtggagttcctggggccc
gtggccttggcccggcctggccctcgcccacgtggcccccgcccactgcccgccaggccc
cgagatgggccccctgagccaggccttacactccctgacctacccgagcagttctccccc
cctgatgtggctccccctatcctggtgaagctggtggaggccattgaacggacagggctg
gacagctacaggcctgagccacccgctgtgcgcacagactggtccctgagtgatgtggag
cagtgggatgcggcagccctgtcagatggtgtgaaaggcttcctgctggcgctgccagcg
cccctcgtgacacccgaggctgcggccgaggcacaccgagccctgcgggaggctgcgggg
cccgtggggccggccttggagcccccgacgctgccactgcaccatgcgctcacgctgcgc
ttcctgctccagcacctgggccgggtggccgggcgcgccccagccccgggccccgcggtc
cgtgccctgggcgccaccttcgggccgctgctgctgcgcgcgccgccgccgccctctccg
ccgccagggggcgcacccgacgggaccgagcccacccccgactttcctgcgctgctggtg
gagaagctgcttcaggaacatctggaggagcaggaggttgcccccccagcactgccacca
aaaccccccaagacaaagccagcccccacaggtctggccaatgggggcagcccaccctcc
ctgcaggacgccgagtggtactggggtgacatctccagggaggaggtaaacgagaaacta
cgggacacgcccgatggcaccttcctggtccgagatgcctccagcaagatccagggagag
tacacgctgaccctcaggaagggcggaaacaacaagctgatcaaggtcttccaccgagac
gggcactacggcttctcggagccgctcaccttctgctctgttgtggacctcatcacccac
taccgccacgagtcactggcccagtacaacgccaagctggacacccggctcctctaccca
gtgtccaagtaccaacaggaccagatcgtcaaggaggacagcgtggaggcggtgggtgcc
cagctcaaggtctaccaccagcagtaccaggacaagagccgcgagtacgaccagctctac
gaggagtacacgcgcacctcccaggaactgcagatgaagcgcacagccatcgaagccttc
aatgagaccatcaagatctttgaagagcagggccagacgcaggagaagtgcagcaaggaa
tatctggagcgcttccgacgtgagggcaacgagaaagaaatgcagaggatcctgctaaac
tcggagcggctcaagtctcgcattgccgagatccacgagagccgcacaaagctggagcag
gagctgcgggcacaggcctctgacaaccgagagatcgacaagcgcatgaacagcctcaag
ccagacctcatgcagttgcgcaagatccgagaccagtaccttgtgtggctcactcagaag
ggtgcccggcagaagaaaatcaacgaatggttggggatcaagaatgagactgaggaccag
tactcactgatggaggatgaggatgacctcccccaccacgaggaacgcacctggtatgta
ggcaagatcaaccgcacccaagctgaggaaatgctgagtggcaagcgggacggtaccttc
ctcatccgtgagagcagccagaggggttgctacgcctgttctgtggtggtggacggggac
accaagcactgcgtcatctaccgcacggccacgggcttcggcttcgcggagccctacaac
ctgtacgggtccctgaaggagctcgtcctccactaccagcacgcctccctggtgcagcac
aacgatgcgctgaccgtcacgctcgctcaccccgtgcgcgcccccgggcctgggcccccg
ccggctgcgcgctga

KEGG   Bubalus bubalis (water buffalo): 102404610
Entry
102404610         CDS       T05912                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00562  Inositol phosphate metabolism
bbub01100  Metabolic pathways
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04070  Phosphatidylinositol signaling system
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04613  Neutrophil extracellular trap formation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04670  Leukocyte transendothelial migration
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04960  Aldosterone-regulated sodium reabsorption
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05100  Bacterial invasion of epithelial cells
bbub05132  Salmonella infection
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05146  Amoebiasis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102404610 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102404610 (PIK3CD)
   04014 Ras signaling pathway
    102404610 (PIK3CD)
   04015 Rap1 signaling pathway
    102404610 (PIK3CD)
   04370 VEGF signaling pathway
    102404610 (PIK3CD)
   04630 JAK-STAT signaling pathway
    102404610 (PIK3CD)
   04668 TNF signaling pathway
    102404610 (PIK3CD)
   04066 HIF-1 signaling pathway
    102404610 (PIK3CD)
   04068 FoxO signaling pathway
    102404610 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102404610 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102404610 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102404610 (PIK3CD)
   04024 cAMP signaling pathway
    102404610 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102404610 (PIK3CD)
   04152 AMPK signaling pathway
    102404610 (PIK3CD)
   04150 mTOR signaling pathway
    102404610 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102404610 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    102404610 (PIK3CD)
   04218 Cellular senescence
    102404610 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102404610 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102404610 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102404610 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102404610 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    102404610 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102404610 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102404610 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102404610 (PIK3CD)
   04660 T cell receptor signaling pathway
    102404610 (PIK3CD)
   04662 B cell receptor signaling pathway
    102404610 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102404610 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102404610 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102404610 (PIK3CD)
   04062 Chemokine signaling pathway
    102404610 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102404610 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    102404610 (PIK3CD)
   04929 GnRH secretion
    102404610 (PIK3CD)
   04915 Estrogen signaling pathway
    102404610 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102404610 (PIK3CD)
   04917 Prolactin signaling pathway
    102404610 (PIK3CD)
   04926 Relaxin signaling pathway
    102404610 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    102404610 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102404610 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102404610 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102404610 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    102404610 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102404610 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102404610 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    102404610 (PIK3CD)
   04380 Osteoclast differentiation
    102404610 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    102404610 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102404610 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102404610 (PIK3CD)
   05206 MicroRNAs in cancer
    102404610 (PIK3CD)
   05205 Proteoglycans in cancer
    102404610 (PIK3CD)
   05203 Viral carcinogenesis
    102404610 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102404610 (PIK3CD)
   05231 Choline metabolism in cancer
    102404610 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102404610 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102404610 (PIK3CD)
   05212 Pancreatic cancer
    102404610 (PIK3CD)
   05225 Hepatocellular carcinoma
    102404610 (PIK3CD)
   05226 Gastric cancer
    102404610 (PIK3CD)
   05214 Glioma
    102404610 (PIK3CD)
   05221 Acute myeloid leukemia
    102404610 (PIK3CD)
   05220 Chronic myeloid leukemia
    102404610 (PIK3CD)
   05218 Melanoma
    102404610 (PIK3CD)
   05211 Renal cell carcinoma
    102404610 (PIK3CD)
   05215 Prostate cancer
    102404610 (PIK3CD)
   05213 Endometrial cancer
    102404610 (PIK3CD)
   05224 Breast cancer
    102404610 (PIK3CD)
   05222 Small cell lung cancer
    102404610 (PIK3CD)
   05223 Non-small cell lung cancer
    102404610 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102404610 (PIK3CD)
   05017 Spinocerebellar ataxia
    102404610 (PIK3CD)
   05020 Prion disease
    102404610 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102404610 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102404610 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    102404610 (PIK3CD)
   04931 Insulin resistance
    102404610 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102404610 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102404610 (PIK3CD)
   05135 Yersinia infection
    102404610 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    102404610 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102404610 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    102404610 (PIK3CD)
   05161 Hepatitis B
    102404610 (PIK3CD)
   05160 Hepatitis C
    102404610 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    102404610 (PIK3CD)
   05164 Influenza A
    102404610 (PIK3CD)
   05162 Measles
    102404610 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    102404610 (PIK3CD)
   05163 Human cytomegalovirus infection
    102404610 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102404610 (PIK3CD)
   05169 Epstein-Barr virus infection
    102404610 (PIK3CD)
   05165 Human papillomavirus infection
    102404610 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102404610 (PIK3CD)
   05142 Chagas disease
    102404610 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102404610 (PIK3CD)
   01524 Platinum drug resistance
    102404610 (PIK3CD)
   01522 Endocrine resistance
    102404610 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102404610 (PIK3CD)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102404610 (PIK3CD)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102404610 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 102404610
NCBI-ProteinID: XP_006076755
LinkDB
Position
5
AA seq 1044 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLQDPEVNDFRGKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRVLLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFYIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAP
HPVYYPSQEKILELGRLGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRRIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDVVKVSSQKTTKPQTKELMHLCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGTVGIIFKN
GDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagaacgtg
gcagttgatttcttgctccccacaggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcactatcaagaaggtgttatggcaccgagcccagtacgagccgctcttccac
atgctcagtgaccctgaggcctacgtgttcacctgcgtcaaccagacggcggagcagcag
gagctggaggacgagcagcggcggctctgcgacatccagcccttcctgcccgtcctgcgg
ctggtggcccgcgagggtgaccgcgtgaagaagctcatcaactcgcagatcagcctgctc
atcggcaaaggcctccacgagtttgactccttgcaagacccggaggtgaatgacttccga
ggcaagatgcgccagttctgcgaggaggcggctgcccgcaggcagcagctgggctgggag
gcctggctgcagtacagcttccctctgcagttggagccctcggcgcggagctgggggcca
ggcaccctgcgcgtccccaatcgggtcctcctggtcaatgtcaagtttgagggcagcgag
gagagcttcaccttccaggtatccaccaaggatgtgcccctggcactgatggcctgtgcc
ctccgaaagaaggccacggtgttccggcagccgctcgtggagcagcctgaggactacaca
ctgcaggtgaacggcaagcacgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagtgggctgaccccgcacctgaccatggtgcactcctcc
tccatcctcgccatgcgggatgagcagagcaaccccgccccccaagtccagaagccacgc
accaaaccgccccccatccccatgaagaagccctcctccttgtccctctggtccctggag
cagcctttctacatcgagctgatccagggcagcaaagtgaatgccgatgagcggatgaag
ctggtggtgcaggccgggctcttccacggcaatgagacgctatgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaagcagcggctggagtttgacatcaac
gtctgtgacctgccccgcatggcccggctctgcttcgcactttacgctgtgatcgagaag
gccaagaaggcccgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagacgggcgagcgctgtctctat
atgtggccctctgtcccagatgagaaaggggagctactgaacccctgtgggaccgtacgg
agtaaccccaacactgagagtgcagctgccctggtcatctttctccccgaggtggcccct
caccctgtatactacccttcccaggaaaagatcctggagctggggcggcttggagagcac
ggacgcttcacggaggaggagcagctgcagctgcgggagatcctggagcggcggggttcc
ggggaactgtacgagcacgagaaggacctggtgtggaagatgcggcacgagatccaggag
cactttcccgaggctctagcccggctgctgctggtcactaagtggaacaaacatgaggac
gtggcccagatgctctacctgctctgctcctggcctgaactgcccgttctgagcgcccta
gagttgctagacttcagcttccccgaccgccacgtgggatccttcgccatcaagtccctg
cggaaactaacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaaattcctgctggaccgggccctggccaat
cgcaggatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggccttatcatggaagcctattgccggggcagcacccaccacatgaaa
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctgaacgacgtcgtcaaa
gtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacttgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaaacccctgtgg
gtcatgtacagcaacgaggaagcaggcagtgacggcaccgtgggcatcatctttaagaat
ggggacgacctccgccaggacatgctgaccctgcagatgatccagctcatggacattctg
tggaagcaggagggcctggacctgaggatgaccccctacggctgcctctccactggggac
cgcacaggccttatcgaggtggtgcttcactcagacaccattgccaacatccagctgaac
aagagcaacatggcggccacggccgccttcaataaggatgctctgctcaactggctcaag
tccaagaaccctggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggctacctatgtgctgggcattggcgatcgccacagcgacaacatcatg
atccgagagaacgggcagctgttccacattgatttcggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgggtcccgttcatcctcacctatgactttgtccac
gtgatccagcaagggaagacgaataatagtgagaagtttgaaaggttccggggctactgt
gagagggcctacaccatcctgcggcgccatgggctccttttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggat
tctctggcattggggaaaacggaggaggaggctctgaagcacttccgagtgaagtttaat
gaagccctccgggaaagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaataa

KEGG   Bubalus bubalis (water buffalo): 102415109
Entry
102415109         CDS       T05912                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04070  Phosphatidylinositol signaling system
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04140  Autophagy - animal
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04218  Cellular senescence
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04613  Neutrophil extracellular trap formation
bbub04620  Toll-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04670  Leukocyte transendothelial migration
bbub04722  Neurotrophin signaling pathway
bbub04725  Cholinergic synapse
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04926  Relaxin signaling pathway
bbub04929  GnRH secretion
bbub04930  Type II diabetes mellitus
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04935  Growth hormone synthesis, secretion and action
bbub04960  Aldosterone-regulated sodium reabsorption
bbub04973  Carbohydrate digestion and absorption
bbub05010  Alzheimer disease
bbub05017  Spinocerebellar ataxia
bbub05020  Prion disease
bbub05100  Bacterial invasion of epithelial cells
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05146  Amoebiasis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102415109 (PIK3R1)
   04014 Ras signaling pathway
    102415109 (PIK3R1)
   04015 Rap1 signaling pathway
    102415109 (PIK3R1)
   04370 VEGF signaling pathway
    102415109 (PIK3R1)
   04630 JAK-STAT signaling pathway
    102415109 (PIK3R1)
   04668 TNF signaling pathway
    102415109 (PIK3R1)
   04066 HIF-1 signaling pathway
    102415109 (PIK3R1)
   04068 FoxO signaling pathway
    102415109 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    102415109 (PIK3R1)
   04072 Phospholipase D signaling pathway
    102415109 (PIK3R1)
   04071 Sphingolipid signaling pathway
    102415109 (PIK3R1)
   04024 cAMP signaling pathway
    102415109 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    102415109 (PIK3R1)
   04152 AMPK signaling pathway
    102415109 (PIK3R1)
   04150 mTOR signaling pathway
    102415109 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102415109 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    102415109 (PIK3R1)
   04218 Cellular senescence
    102415109 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102415109 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102415109 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102415109 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102415109 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    102415109 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    102415109 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    102415109 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    102415109 (PIK3R1)
   04660 T cell receptor signaling pathway
    102415109 (PIK3R1)
   04662 B cell receptor signaling pathway
    102415109 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    102415109 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    102415109 (PIK3R1)
   04670 Leukocyte transendothelial migration
    102415109 (PIK3R1)
   04062 Chemokine signaling pathway
    102415109 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102415109 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    102415109 (PIK3R1)
   04929 GnRH secretion
    102415109 (PIK3R1)
   04915 Estrogen signaling pathway
    102415109 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    102415109 (PIK3R1)
   04917 Prolactin signaling pathway
    102415109 (PIK3R1)
   04926 Relaxin signaling pathway
    102415109 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    102415109 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    102415109 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102415109 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102415109 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    102415109 (PIK3R1)
   04722 Neurotrophin signaling pathway
    102415109 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102415109 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102415109 (PIK3R1)
   04380 Osteoclast differentiation
    102415109 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    102415109 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    102415109 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102415109 (PIK3R1)
   05206 MicroRNAs in cancer
    102415109 (PIK3R1)
   05205 Proteoglycans in cancer
    102415109 (PIK3R1)
   05203 Viral carcinogenesis
    102415109 (PIK3R1)
   05230 Central carbon metabolism in cancer
    102415109 (PIK3R1)
   05231 Choline metabolism in cancer
    102415109 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102415109 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102415109 (PIK3R1)
   05212 Pancreatic cancer
    102415109 (PIK3R1)
   05225 Hepatocellular carcinoma
    102415109 (PIK3R1)
   05226 Gastric cancer
    102415109 (PIK3R1)
   05214 Glioma
    102415109 (PIK3R1)
   05221 Acute myeloid leukemia
    102415109 (PIK3R1)
   05220 Chronic myeloid leukemia
    102415109 (PIK3R1)
   05218 Melanoma
    102415109 (PIK3R1)
   05211 Renal cell carcinoma
    102415109 (PIK3R1)
   05215 Prostate cancer
    102415109 (PIK3R1)
   05213 Endometrial cancer
    102415109 (PIK3R1)
   05224 Breast cancer
    102415109 (PIK3R1)
   05222 Small cell lung cancer
    102415109 (PIK3R1)
   05223 Non-small cell lung cancer
    102415109 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102415109 (PIK3R1)
   05017 Spinocerebellar ataxia
    102415109 (PIK3R1)
   05020 Prion disease
    102415109 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102415109 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102415109 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    102415109 (PIK3R1)
   04931 Insulin resistance
    102415109 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102415109 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102415109 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    102415109 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102415109 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    102415109 (PIK3R1)
   05161 Hepatitis B
    102415109 (PIK3R1)
   05160 Hepatitis C
    102415109 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    102415109 (PIK3R1)
   05164 Influenza A
    102415109 (PIK3R1)
   05162 Measles
    102415109 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    102415109 (PIK3R1)
   05163 Human cytomegalovirus infection
    102415109 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102415109 (PIK3R1)
   05169 Epstein-Barr virus infection
    102415109 (PIK3R1)
   05165 Human papillomavirus infection
    102415109 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102415109 (PIK3R1)
   05142 Chagas disease
    102415109 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102415109 (PIK3R1)
   01524 Platinum drug resistance
    102415109 (PIK3R1)
   01522 Endocrine resistance
    102415109 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102415109 (PIK3R1)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102415109 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 DUF4201 Laminin_I Lant_dehydr_C Mod_r PI_PP_I
Other DBs
NCBI-GeneID: 102415109
NCBI-ProteinID: XP_006054637
LinkDB
Position
19
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGPSKTEADSEQQASTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASLDLEMFDVH
VLADAFKRYLLDLPNPVIPVAVSSELISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggtaccagtaccgggcgctgtacgactataagaaggagcgggaagaa
gacattgacttgcacctgggggacattctgactgtgaacaaaggctccttagtcgctctt
ggattcagtgatggacaggaagccaagcctgaagaaattggctggttaaatggctataac
gagacgacaggggagaggggagactttccgggaacttacgtagaatatattggaaggaaa
aagatctcgcctcccacaccaaagccccggccacctcgaccccttcctgttgctccaggt
ccttcaaaaactgaagcagacagtgagcaacaagcttccactctcccggaccttgcagag
cagttcgcaccccctgacgttgctccaccgcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagccgag
ttacgacagcttcttgattgtgatgccgcctccttggacttggagatgttcgatgtgcac
gttttagctgacgccttcaaacgctatctcctggacttaccgaatcctgtcattccggta
gctgtttccagtgaactgatttctttagccccagaagtgcagagttccgaagaatacatc
cagctgttgaagaaactcattaggtcacccagcatacctcatcagtactggctcacactg
cagtatttgctaaaacatttcttcaagctctctcaaacgtccagcaaaaatcttctgaat
gcaagagtactttctgaactcttcagccctctgcttttcagattcccagcagcaagttct
gagaatactgaacacctcataaaaattatagaaatcttaatctccaccgaatggaatgaa
cgccagcctgcaccagcactgcctcccaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtctttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagacacagctgatgggacctttttggtacgagacgca
tctactaaaatgcacggggattacacgcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaactaataaaccactaccggaatgaatctctagctcagtataatcccaaactg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaagactatacccgaacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacc
caggagcggtacagcaaagaatacatagaaaagttcaaacgtgaaggcaatgagacggaa
atccaaaggattatgcataattatgaaaagttaaagtctcgaatcagtgaaattgtcgac
agcagaaggagattggaagaggacttgaagaagcaggcggctgagtatcgtgagattgac
aaacgcatgaacagcattaaaccagacctcattcagctaagaaagacgagagaccaatac
ttgatgtggttgactcagaaaggtgttcggcagaagaaattgaacgagtggctgggcaat
gaaaacactgaagaccaatattcgctggtagaagatgatgaggatttgccccaccacgac
gagaagacttggaatgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgagga
aagcgagacggcacttttcttgtccgggaaagcagtaaacagggctgctacgcctgctct
gtggtggtggacggcgaggtcaagcactgcgtcatcaacaagacggccacgggctacggc
ttcgccgagccctacaacctgtacagctccctcaaggagctggtgctccactaccagcac
acctccctcgtgcagcacaatgactccctcaacgtcacactagcctacccggtgtacgcg
cagcagaggcgatga

DBGET integrated database retrieval system