KEGG   Bubalus bubalis (water buffalo): 102395421
Entry
102395421         CDS       T05912                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04061  Viral protein interaction with cytokine and cytokine receptor
bbub04151  PI3K-Akt signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub04660  T cell receptor signaling pathway
bbub04672  Intestinal immune network for IgA production
bbub04940  Type I diabetes mellitus
bbub05135  Yersinia infection
bbub05142  Chagas disease
bbub05162  Measles
bbub05166  Human T-cell leukemia virus 1 infection
bbub05200  Pathways in cancer
bbub05320  Autoimmune thyroid disease
bbub05321  Inflammatory bowel disease
bbub05330  Allograft rejection
bbub05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102395421 (IL2)
   04151 PI3K-Akt signaling pathway
    102395421 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102395421 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102395421 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102395421 (IL2)
   04660 T cell receptor signaling pathway
    102395421 (IL2)
   04658 Th1 and Th2 cell differentiation
    102395421 (IL2)
   04659 Th17 cell differentiation
    102395421 (IL2)
   04672 Intestinal immune network for IgA production
    102395421 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102395421 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102395421 (IL2)
   05321 Inflammatory bowel disease
    102395421 (IL2)
   05330 Allograft rejection
    102395421 (IL2)
   05332 Graft-versus-host disease
    102395421 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102395421 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102395421 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102395421 (IL2)
   05162 Measles
    102395421 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102395421 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102395421 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:bbub00536]
    102395421 (IL2)
Cytokines and growth factors [BR:bbub04052]
 Cytokines
  Interleukins
   102395421 (IL2)
Glycosaminoglycan binding proteins [BR:bbub00536]
 Heparan sulfate / Haparin
  Cytokines
   102395421 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 102395421
NCBI-ProteinID: NP_001277784
UniProt: A4GRE1
LinkDB
Position
17
AA seq 155 aa
MYKIQLLSCIVLTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH
TFNFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQG
SETGFTCEYDDATVKAVEFLNKWITFCQSIYSTMT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaagatacaactcttgtcttgcattgtactaactcttgcactcgttgcaaacggt
gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat
ttacagttgcttttggagaaagttaaaaatcctgagaacctcaagctctccaggatgcat
acatttaacttttacgtgcccaaggttaacgctacagaattgaagcatcttaagtgttta
ctagaagaactcaaacttctagaggaagtgctaaatttagctccaagcaaaaacctgaac
cccagagagatcaaggattcaatggacaatatcaagagaatagttttggaactacaggga
tctgaaacaggattcacatgtgaatatgatgatgcgacagtaaaggctgtagaatttctg
aacaaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system