KEGG   Bubalus bubalis (water buffalo): 102395457Help
Entry
102395457         CDS       T05912                                 

Gene name
CRAT
Definition
(RefSeq) carnitine O-acetyltransferase isoform X3
  KO
K00624  carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102395457 (CRAT)
Enzymes [BR:bbub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.7  carnitine O-acetyltransferase
     102395457 (CRAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 102395457
NCBI-ProteinID: XP_006065370
LinkDB All DBs
Position
12
AA seq 626 aa AA seqDB search
MENGQQKEKVKPLGLLKPSSLMKVSSRFKAHQDSLPRLPVPPLQQTLDHYLKALQPIVSE
EEWAQTKQLVEEFQTAGGVGERLQKGLERRARKMENWLSDWWLKTAYLQYRQPLVIYSSP
GVMLPKQDFVDRQGQLRFAAKLIEGVLDFKAMIDNETLPVEYLGGKPLCMNQYYQILSSC
RVPGPKQDLVTKFSRTKKPPMHITVVHNYQFFELDVYHSDGTPLTSDQIFMQLEKVWNSS
LQTNKEPVGILTSNHRNSWAKAYSTLIKDKVNRESVHSIQRSIFTVCLDAPMPRVSEDTY
RSQVAGQMLHGGGSKLNSGNRWFDKTLQFIVAEDGACGLIYEHAAAEGPPIVSLLDHVIE
FTKRPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKD
FPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVK
AMDDPNVTEHEKVELLRKAVQAHRAYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMD
TSYAIAMHFNLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMETHINFSVSAYNSCAETNA
VHLAHYLEKALLDMRALLQSHPRAKL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgggcagcagaaggagaaggtgaagcccctgggcctcctcaagccctcctcc
ttgatgaaggtttctagtcgctttaaggcacatcaggactcgctcccccggctgcccgtg
cccccactccagcagaccctggaccattatctcaaggcgctgcagcccatcgtgagcgag
gaggaatgggcccaaaccaagcagctggtggaagagttccagacagcaggcggcgtgggg
gagcgcctgcagaaggggctggagcgcagggccaggaagatggagaactggctgtccgac
tggtggctcaaaacagcctacctccagtaccgccagcccttggtcatctactccagccct
ggtgtgatgctgccaaagcaggactttgtggatcggcagggccagctccggttcgctgcc
aaattaatcgagggcgtgttggatttcaaggccatgattgacaacgagaccctgcccgtg
gagtacctggggggcaagccactgtgcatgaaccagtactatcagatcctgtcgtcctgc
cgtgtgccgggccccaagcaggatttggtcaccaagttcagcaggaccaagaagccacct
atgcacatcaccgtggtgcacaactaccaattttttgagttggatgtgtaccacagcgat
gggacacccctgacctcagatcagatcttcatgcagctggagaaggtctggaactcatca
ctgcaaaccaacaaggagcctgtgggcatcctcacctccaaccaccgtaactcctgggcc
aaggcctacagcaccctcatcaaagacaaggtgaaccgggagtcagtgcactccatccag
aggagcattttcactgtgtgcctggacgcacccatgcctcgggtctcagaagacacatac
cgcagccaagtggcgggccagatgctgcatgggggcggcagcaagctcaacagcggcaac
cgctggttcgacaagacactgcagttcatcgtggccgaagatggcgcctgtgggctcatc
tacgagcatgcggcagccgagggaccccccatcgtctccctcttggaccacgtcatcgag
ttcacgaagaggccagaactcgtgcggtctcccatggttcccctgcccatgcccaagaag
ctgcggttcaacatcacgcctgagatcaagagcgacattgagaaggccaagcagaacctc
agcatcatgatccaggacctggacatcacggtaatggtgttccaccactttggaaaggac
ttccccaaatcggagaagctgagcccagatgccttcatccagatggcactgcagctggcc
tactacaggatctacgggcaggcttgtgccacctacgaaagtgcctctctgcgcatgttc
cacctgggccggaccgacaccatccgctcagcctccatggactcactgaccttcgtcaag
gccatggatgatcccaatgtgacggagcacgaaaaggtggagctgctgcggaaggccgtg
caggcccaccgagcctacaccgaccgggccatccgtggggaggcctttgaccggcacctg
ctgggcctgaagctgcaggccatcgaagacctagtgagtatgcccgacatcttcatggac
acctcctacgccatcgccatgcacttcaacctctccaccagccaggtccccgccaagaca
gactgtgtcatgttctttgggcctgtggtgccagacggctatggcgtctgctataacccc
atggagacacacatcaacttctccgtgtcagcctacaacagctgtgccgagaccaacgcg
gtccacctggcacactatctggagaaggcactcctggacatgcgggctctgctccagagc
cacccccgggccaagctctga

DBGET integrated database retrieval system