KEGG   Bubalus bubalis (water buffalo): 102395689
Entry
102395689         CDS       T05912                                 

Gene name
GSS
Definition
(RefSeq) glutathione synthetase isoform X1
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00270  Cysteine and methionine metabolism
bbub00480  Glutathione metabolism
bbub01100  Metabolic pathways
bbub01240  Biosynthesis of cofactors
bbub04216  Ferroptosis
Module
bbub_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102395689 (GSS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102395689 (GSS)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102395689 (GSS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102395689 (GSS)
Enzymes [BR:bbub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     102395689 (GSS)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102395689 (GSS)
SSDB
Motif
Pfam: GSH_synth_ATP GSH_synthase
Other DBs
NCBI-GeneID: 102395689
NCBI-ProteinID: XP_006048148
LinkDB
Position
14
AA seq 478 aa
MPVGMATGWGSLLQDEQQLEELARQAVDRALAEGVLLRTSQAPSSSHVVSYAPFTLFPSP
VPSALLEQAYAVQADFNLLVDAVSQNAVFLEQTLSSTIKRDSFTARLFDIHKQVLKEGIA
QTVFLGLNRSDYMFQCNPDGSAALKQIEINTISASFGGLASRTPAVHRHVLSVLGKTKEA
AKILSNNPSKGLAMGIAKAWELYGSANAQVLLIAQEKERNIFDQRAIENELLARNIHVIR
RRFEDVSEKGSLDQDRRLFMDGQEVAVVYFRDGYMPGHYSLQNWEARLLLERSCAVKCPD
IATQLAGTKKVQQELSRVGVLESLLPGQPEAVARLRATFAGLYSLDLGEEGDQAITKAIA
APSCFVLKPQREGGGNNLYGEEMVQALERLKDSEERASYILMEKIEPEPFRNCLLRPGSP
ARVIQCISELGIFGVYVREGKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgccggttgggatggccaccggctgggggagcctcttgcaggatgaacagcagctggag
gagctagcgaggcaggctgtggaccgggccctggctgagggtgtgttgctgaggacctca
caggcacccagctcctctcatgtggtgagctatgctccattcacactcttcccttcacca
gtcccaagtgccctgcttgagcaggcctatgctgtgcaggcggacttcaacctcctggtg
gatgcggtcagccaaaacgctgtctttctggagcagactctctccagcaccatcaaaaga
gacagctttactgctcgtctctttgacatccacaagcaagtcttaaaagaaggcattgcc
cagaccgtgttcctgggcttgaatcgctcagactacatgttccagtgcaatccggatggc
tccgcagccctgaaacagattgaaatcaacaccatctctgccagctttgggggcctagcc
tcccggaccccagctgtgcatcgacatgttctcagtgtcctgggtaagaccaaagaagct
gccaagatcctctccaataatcccagcaagggactggccatggggattgccaaagcctgg
gagctctacggctcagccaatgctcaggtgctactgattgctcaagagaaggaaaggaac
atatttgaccagcgtgccatagagaatgagctactggccaggaatatccatgtaatccga
cgaaggttcgaagatgtctctgaaaaggggtctctagaccaagaccgaagactatttatg
gacggccaggaggttgctgtggtttacttccgggatggctacatgccaggccattacagc
ctacagaactgggaagcacgcctgctcctggagaggtcatgtgctgtcaagtgcccggac
attgccacccagctggccgggaccaagaaggtgcagcaggagctaagcagagtgggcgtg
ctggagtccttgctcccagggcagcctgaggctgtggcccgcctccgtgccacctttgct
ggcctctactcactagacctgggtgaagaaggggaccaggctatcaccaaggccattgct
gcccctagctgcttcgtgctaaagcctcaaagagagggtggaggtaacaacctatacggg
gaggagatggtacaagccctggagcggctgaaggacagtgaggagagagcctcctacatc
ctcatggagaagattgaacccgaaccttttaggaattgtctactacgacccggcagccct
gctcgagtgatccaatgcatttcagagctgggcatcttcggggtctatgtcagggaggga
aagacacttgtgatgaacaagcacgtgggacatctgcttcgaaccaaagccatcgagcac
gcagatggcggtgtggcggctggagtggcagtcctggacaacccgtaccctgtgtga

DBGET integrated database retrieval system