KEGG   Bubalus bubalis (water buffalo): 102395741Help
Entry
102395741         CDS       T05912                                 

Gene name
HSD17B12
Definition
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00062  Fatty acid elongation
bbub00140  Steroid hormone biosynthesis
bbub01040  Biosynthesis of unsaturated fatty acids
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
Module
bbub_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    102395741 (HSD17B12)
   00140 Steroid hormone biosynthesis
    102395741 (HSD17B12)
   01040 Biosynthesis of unsaturated fatty acids
    102395741 (HSD17B12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102395741 (HSD17B12)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     102395741 (HSD17B12)
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     102395741 (HSD17B12)
Lipid biosynthesis proteins [BR:bbub01004]
 Fatty acid synthase
  Component type
   102395741 (HSD17B12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Epimerase 3HCDH_N Sacchrp_dh_NADP TrkA_N NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 102395741
NCBI-ProteinID: XP_025121984
LinkDB All DBs
Position
16
AA seq 312 aa AA seqDB search
MESFLPATGFLYWVGAGTVAYLALHILCLLFTAVRVWGLGNESGVGPRLGEWAVVTGSTD
GIGKSYAEELAKRGMKIVLISRSQDKLNQVSSEIREKFEVETKTIAVDFTLEDIYDKIRT
SLAGLEIGVLVNNVGMSYEYPEYFLDIPDLDNTIKKLISVNVLSVCKMTQLVLPGMVERS
KGIILNISSATGMYPVPLLTIYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKLA
KIGKPTLDKPSSEMFVKSAIKTIGVQSRTNGYFIHYLMASVASILPSWLCFKMVMNVNKS
LRARYFKKMKKN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagagctttttgcctgccaccggtttcctgtattgggtgggcgcgggcaccgtggcc
tacctggccctgcatatcttgtgcttgctcttcacggccgttcgggtctggggtttgggt
aacgagtcgggggtcggaccgaggctcggtgaatgggcagttgtcacaggtagtactgat
ggaattggaaaatcatatgcagaagagttagcaaagcgtggaatgaaaattgtccttatc
agcagatcacaggacaaactgaaccaggtttccagtgagataagagaaaaattcgaagtg
gaaacaaagaccattgccgttgactttacgttagaagatatttatgacaaaatcagaaca
agcttggcaggtctcgagattggtgttttagtgaacaatgtgggaatgtcatatgagtat
ccggaatactttttggatattcctgacttggacaataccatcaagaaactgataagtgtt
aatgtcctttctgtttgcaagatgacacagctggtcctgcctggcatggtagaaagatct
aaaggcataattctgaacatctcctctgccactggcatgtacccagtcccactgttgacc
atctactctgcaaccaaggcttttgtagatttcttctctcaatgcctccatgaggaatat
aagagcaagggcatctttgtgcagagtgtcctgcccttctttgttgcaaccaaactggct
aaaatcggaaagccaactttggataagccctcttcggagatgtttgtgaagtctgccatt
aaaaccattggcgtgcaatcccggaccaatggatacttcatccattatcttatggcctca
gtagcctcaatcctgccttcctggttgtgttttaaaatggtcatgaatgtgaacaaatcc
ctccgggctcgctattttaaaaaaatgaagaagaactga

DBGET integrated database retrieval system