KEGG   Bubalus bubalis (water buffalo): 102395749Help
Entry
102395749         CDS       T05912                                 

Gene name
PRMT1
Definition
(RefSeq) protein arginine N-methyltransferase 1 isoform X1
  KO
K11434  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102395749 (PRMT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102395749 (PRMT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102395749 (PRMT1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     102395749 (PRMT1)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     102395749 (PRMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 PrmA Methyltransf_11 Methyltransf_23 Methyltransf_31 MTS Methyltransf_9 Met_10 DOT1 CMAS PRMT5 PCMT Methyltransf_16 Methyltransf_12 GidB
Motif
Other DBs
NCBI-GeneID: 102395749
NCBI-ProteinID: XP_006080146
LinkDB All DBs
Position
18
AA seq 371 aa AA seqDB search
MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF
GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECS
SISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYA
RDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVV
DPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG
FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC
ELSCSTDYRMR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagccgaggccgcgaactgcatcatggagaattttgtagccaccttggctaat
gggatgagcctccagccgcctcttgaagaagtctcctgtggccaggcagaaagcagcgag
aagcccaacgctgaggacatgacgtccaaagattactactttgactcctacgctcacttc
ggcatccacgaggaaatgctgaaagatgaggtccgcaccctcacataccgcaactccatg
tttcacaaccggcaccttttcaaagacaaggtggtgctggacgtgggctcgggcacaggg
atcctctgcatgtttgccgccaaggctggggcccgcaaggtcatcgggatcgagtgttcc
agtatctctgattatgcggtgaagatcgtcaaagccaacaagttagaccatgtggtgacc
atcatcaaggggaaggtggaggaggtagagctcccggtagagaaggtggacatcatcatc
agcgagtggatgggctactgcctcttctacgagtcgatgctcaacaccgtgctctacgcc
cgagacaagtggctggcacccgatggcctcatcttcccagatcgagccacgctgtacgtg
acggccatcgaggaccggcagtacaaagactacaagatccactggtgggagaatgtgtac
ggcttcgacatgtcttgcatcaaagacgtggccatcaaggagcccctggtggatgtggtg
gaccccaagcagctggtcaccaatgcctgcctcatcaaggaggtggacatctacacagtc
aaggtggaagacctgaccttcacctcccccttctgcctgcaagtgaagcggaacgactat
gtgcacgccctggtggcctatttcaacatcgagttcacccgctgccacaagaggaccggc
ttctccaccagccccgagtccccctacactcactggaagcagacagtgttctacatggag
gactacctgacggtgaagacgggcgaggagatctttggcaccatcggcatgcggcccaac
gccaagaacaaccgtgacctggacttcaccatcgacctggacttcaagggccagctgtgc
gagctctcctgctccactgactaccggatgcgctga

DBGET integrated database retrieval system