KEGG   Bubalus bubalis (water buffalo): 102395921
Entry
102395921         CDS       T05912                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member B1 isoform X1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00340  Histidine metabolism
bbub00350  Tyrosine metabolism
bbub00360  Phenylalanine metabolism
bbub00410  beta-Alanine metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102395921
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102395921
   00350 Tyrosine metabolism
    102395921
   00360 Phenylalanine metabolism
    102395921
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102395921
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102395921
   00982 Drug metabolism - cytochrome P450
    102395921
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102395921
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     102395921
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 102395921
NCBI-ProteinID: XP_025142587
LinkDB
Position
5
AA seq 492 aa
MWVRVGALEGWWRWGHPNRRCPPPGRMDPFADTLQRLREAFVSRRTRPAEFRAAQLKGLS
LFLQENKQLLHEALAQDLYKTAFLSDVSELILCQNEVDLALRNLHTWMKDEPGAKNLMTQ
LDSVFIRKEPFGLVLILSPWNYPLNLSLLPLVGALAAGNCVVLKPSEISKSMMKVLAKVL
PRYLDQSCFAVVLGGPEETGRLLEHEFDYIFFTGSPRVGKIVMAAAAKHLTPVTLELGGK
NPCYVDDNCDPQTVANRVAFFRYFNTGQTCVAPDYVLCSPEMQAQLVPALQSAITRFYGD
DPQSSPNLGRIISQKHFQRLRGLLSCGRVVIGGQSDESNLYIAPTVLVDVQETEPVMQEE
IFGPILPIVNVRSLDQAIDFINRREKPLALYAFSNSSQVVNQMLDRTSSGNFAGNDGFTY
LTLTSLPFGGVGQSGMGRYHGKFSFDTFSHHRACLLSHPGLEMLNNIRYPPYSDFRQKLV
TWALGSHSCTLL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtgggtgcgagtaggggccttggaggggtggtggaggtgggggcaccccaaccgacgt
tgccccccgcccggcaggatggaccccttcgcagacaccctgcagcggctgcgggaggcc
ttcgtctcaaggcgcacgcggccggcggagttccgggccgcccagctgaagggcctgagc
ctcttcctgcaagagaacaagcagcttctgcacgaggcgctggctcaggacctgtacaag
acggcctttctttcggacgtttcagagctcatcctctgccagaacgaggtcgacttggct
ctcaggaacctgcacacctggatgaaggacgagccaggggccaagaacctgatgacgcag
ctggactcggtcttcatccggaaggagcccttcggcctggtgctcatcctgtctccctgg
aactaccccctgaacctgagcctgttgcccctggtgggcgccctcgctgcaggtaactgc
gtggtgctgaaaccttcagagatcagcaagagcatgatgaaggtcctggccaaggtgctg
ccccgatacctggaccagagctgctttgccgtggtgctgggcgggcccgaggagacgggg
cggctgctggagcacgagttcgactacatcttcttcacggggagccctcgagttggcaag
attgtcatggctgctgccgccaagcacctgacgcctgtcacgctggagctgggaggcaag
aacccctgctatgtggacgacaactgcgacccccagaccgtagccaaccgggtggccttc
ttccgctatttcaacaccggccagacctgcgtggcccccgactatgtcctgtgcagtccc
gagatgcaggcgcagctggtgcccgccctgcagagcgccatcacccgtttctatggcgac
gacccccagagctccccaaacctgggccgcatcatcagccagaagcatttccagcggctc
cggggcctgctgagctgcggccgcgtggtcattggcggccagagtgacgaaagcaatctc
tacatcgcccccacagtgctggtggacgtgcaggagaccgagccggtgatgcaggaggag
atcttcgggcccatcttgcccatcgtgaacgtgaggagcctggaccaggccatcgacttc
atcaaccgtcgggagaagcccctggccctctacgccttctccaacagcagccaggtagtg
aaccagatgctggacaggaccagcagcggcaactttgcagggaatgacggcttcacctac
ctgactcttacctccctgccattcgggggagtcggccaaagtgggatgggaagataccat
ggcaagttctccttcgacaccttctcccaccaccgtgcctgcctgctctcccacccgggc
ctggagatgctgaacaacatccgctacccaccctattctgacttcagacagaagctggtc
acctgggccttgggcagccacagctgtacccttctgtga

KEGG   Bubalus bubalis (water buffalo): 102396234
Entry
102396234         CDS       T05912                                 

Gene name
ALDH3B1
Definition
(RefSeq) aldehyde dehydrogenase family 3 member B1 isoform X1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00340  Histidine metabolism
bbub00350  Tyrosine metabolism
bbub00360  Phenylalanine metabolism
bbub00410  beta-Alanine metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102396234 (ALDH3B1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102396234 (ALDH3B1)
   00350 Tyrosine metabolism
    102396234 (ALDH3B1)
   00360 Phenylalanine metabolism
    102396234 (ALDH3B1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102396234 (ALDH3B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102396234 (ALDH3B1)
   00982 Drug metabolism - cytochrome P450
    102396234 (ALDH3B1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102396234 (ALDH3B1)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     102396234 (ALDH3B1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 102396234
NCBI-ProteinID: XP_025142589
LinkDB
Position
5
AA seq 468 aa
MDPFADTLQRLREAFVSGRTRPAEFRAAQLKGLSRFLRENKQLLQEALAQDLHKSAFEAE
VSEISISQNEINLALRNLRAWMKDEKVSKNLATQLDSAFIRKEPFGLVLILSPWNYPLNL
SLGPLVGALAAGNCVVLKPSEISKNTEKVLAEVLPRYLDQSCFAVVLGGPQETGRLLEHK
FDYIFFTGNPQVGKIIMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAFFRYFNT
GQTCVAPDYVLCSPEMQARLVPALQSAITRFYGDDPQSSPNLGRIISQKHFQRLRGLLSC
GRVVIGGQSDECDLYIAPTVLVDVQETDPVMQEEIFGPILPIVNVRSLDQAIDFINRREK
PLALYAFSNSSQVVKRVLAQTSSGGFCGNDGFMHLTLASLPFGGVGSSGMGNYHGKFSFD
TFSHHRACLLRRPGLEKIYAIRYPPHTPRNLRVLLMAMETRSCSCTLL
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggacccctttgcagacaccctgcagcggctgcgggaggctttcgtctcggggcgcacg
cggccggccgagttccgggccgcccagctgaagggcctgagccgcttcctgcgagagaac
aagcagctgctgcaggaggcgctggctcaggacctgcacaagtcagctttcgaggcagag
gtgtctgaaatcagcatcagccagaacgagattaacttggcccttaggaacctgagggcc
tggatgaaggatgagaaagtgtccaagaacctggccacgcagctggactcggccttcatc
cggaaggagcccttcggcctggtgctcatcctgtctccctggaactatcctctgaacctg
agcctggggcccctggtgggtgccctcgcagcagggaactgcgtggtgctgaaaccctcg
gagatcagcaagaacactgagaaggtcctggccgaggtgctgccccgatacctggaccag
agttgctttgctgtggtgctgggtgggccccaggagacggggcggctgctggagcacaag
ttcgactacatcttcttcacggggaaccctcaagttggaaagatcatcatgactgctgct
gccaagcacctgacgcccgtcacgctggagctgggaggcaagaacccctgctatgtggac
gacaactgcgacccccagaccgtggccaaccgggtggccttcttccgctatttcaacacc
ggccagacctgcgtggcccccgactatgtcctgtgcagccctgagatgcaggcacggctg
gtgcccgccctgcagagcgccatcacccgtttctatggcgacgacccccagagctcccca
aacctgggccgcatcatcagccagaagcatttccagcggctccggggcctgctgagctgc
ggccgcgtggtcattggcggccagagtgacgaatgcgatctctacatcgcccccacggtg
ctggtggacgtgcaggagaccgatccggtgatgcaggaggaaatcttcgggcccatcctg
cccatcgtgaacgtgaggagcctggaccaggccatcgacttcatcaaccgtcgggagaag
cccctggccctctacgccttctccaacagcagccaggtggtcaaacgggtcctggcccag
accagcagcgggggcttctgtgggaacgacggcttcatgcacttgaccttggccagcctg
cctttcggaggagtgggcagcagcgggatgggcaactaccacggtaagttctccttcgac
accttctcccaccaccgcgcctgcctgctgcgccgcccggggctggagaagatctacgcc
atccgctacccgccccacactccgcgcaacctgagggtgctgctgatggccatggagacc
cgcagctgcagctgcaccctgctgtga

KEGG   Bubalus bubalis (water buffalo): 102398004
Entry
102398004         CDS       T05912                                 

Gene name
ALDH3A1
Definition
(RefSeq) aldehyde dehydrogenase, dimeric NADP-preferring isoform X1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00340  Histidine metabolism
bbub00350  Tyrosine metabolism
bbub00360  Phenylalanine metabolism
bbub00410  beta-Alanine metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102398004 (ALDH3A1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102398004 (ALDH3A1)
   00350 Tyrosine metabolism
    102398004 (ALDH3A1)
   00360 Phenylalanine metabolism
    102398004 (ALDH3A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102398004 (ALDH3A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102398004 (ALDH3A1)
   00982 Drug metabolism - cytochrome P450
    102398004 (ALDH3A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102398004 (ALDH3A1)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     102398004 (ALDH3A1)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 102398004
NCBI-ProteinID: XP_025136279
LinkDB
Position
3
AA seq 516 aa
MSAISEVVQRARAAFNSGRTRPLQFRIQQLEGLRRLIREREKDLVGALAADLHKNEWTTY
YEEIVYVLEEIDYMIRKLPEWAADEPVEKTPHTQQDEAYIHSEPLGVVLIIGSWNYPFNL
TIQPMVGAIAGGNAVVLKPSELSENTASLLATILPQYLDQDLYPVINGGVAETTEVLKER
FDHILFTGSTGVGRVIMMAAAKHLTPVTLELGGKNPCYVDKDCDLDIACRRITWGKFMNS
GQTCVAPDYILCDPSIQSQIVEKLKKSLKEFYGEDAKKSRDYGRIINSRHFQRVMGLLEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEVFGPVLPIVCVRSLEEAIQFITQREK
PLALYVFSPNDKVIKKMIAETSSGGVTANDVVVHITVHSLPYGGVGDSGMGSYHGRKSFE
TFSHRRSCLVRPLLNEETLKARYPPSPAKVRSGRWGWGWGGGAAGQTRASLPFVSPTDAP
SLKRCPGLTVLHPWRAPLVPRCSSASFPPSPAPTLH
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgagcgcaatcagcgaggtggtgcagcgggccagagccgccttcaactcgggtcggacg
cgcccgctccagttccgcatccagcagctggaggggctgcggcgcctgatccgcgagcga
gagaaggacctcgtgggcgcgctggctgcggacctccacaagaacgaatggaccacctac
tacgaggagattgtgtatgtcctggaggagatcgactacatgatcaggaaactccctgag
tgggctgctgatgagcctgtggagaagaccccccacacccagcaggatgaggcctacatc
cactcggagcccctgggcgtggtcctaatcatcgggagctggaactaccccttcaacctg
accatccagcccatggtgggcgccatcgctggagggaatgcagtggtcctgaagccgtcg
gagctgagtgagaacacggcgagcctgctggccaccatcctcccccagtacctggaccag
gatctgtaccctgtgatcaacgggggtgttgctgagaccacagaggtgctcaaggagaga
ttcgaccacatcctgttcaccgggagcaccggggtgggcagggtcatcatgatggctgcg
gccaagcacctgacccccgtcacactggagctagggggcaagaacccctgctatgtggac
aaggactgcgacctggacattgcctgcagacgcatcacctggggaaagttcatgaacagt
ggccagacttgcgtggcccccgactacatcctgtgtgacccctctatccagagccaaatc
gtggagaagctcaaaaagtccctgaaagagttctacggggaggacgccaagaagtccagg
gactacgggagaatcatcaactcccggcacttccagagggtgatgggcctgctggagggc
cagaaggtcgcctatggaggcaccggggacgcggccacccgctacatcgcccccaccatc
cttacggacgtggacccccagtccccggtgatgcaggaggaggtcttcgggcctgtcctg
cccatcgtgtgtgtgcgcagcctggaggaggccatccagttcatcacccagcgcgagaag
cccctggcgctctacgtcttctcaccgaacgacaaggtgattaagaagatgatcgcggag
acctccagcggcggggtgacagccaacgacgtcgttgtccacatcaccgtgcactcactg
ccctacgggggtgtgggggacagcggcatggggtcctaccacggcaggaagagcttcgag
accttctcgcaccgccgctcctgcctggtgaggcctctgctgaatgaagagaccctcaaa
gccagatatccgccgagcccagccaaggtgagaagtgggaggtggggatgggggtggggt
gggggagccgccggccagacaagggcctcattgcccttcgtgtcccccacagatgccccg
tcactgaagcggtgccctggcctcaccgtgctgcacccttggagggctcctctggtgccc
cgctgctcaagtgcatccttcccacccagccccgcccccacgctacactaa

DBGET integrated database retrieval system