Bubalus bubalis (water buffalo): 102396206 Help Entry 102396206         CDS       T05912                                  Gene name MAPK1 Definition (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01521   EGFR tyrosine kinase inhibitor resistance bbub01522   Endocrine resistance bbub01524   Platinum drug resistance bbub04010   MAPK signaling pathway bbub04012   ErbB signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04022   cGMP-PKG signaling pathway bbub04024   cAMP signaling pathway bbub04062   Chemokine signaling pathway bbub04066   HIF-1 signaling pathway bbub04068   FoxO signaling pathway bbub04071   Sphingolipid signaling pathway bbub04072   Phospholipase D signaling pathway bbub04114   Oocyte meiosis bbub04140   Autophagy - animal bbub04150   mTOR signaling pathway bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04218   Cellular senescence bbub04261   Adrenergic signaling in cardiomyocytes bbub04270   Vascular smooth muscle contraction bbub04350   TGF-beta signaling pathway bbub04360   Axon guidance bbub04370   VEGF signaling pathway bbub04371   Apelin signaling pathway bbub04380   Osteoclast differentiation bbub04510   Focal adhesion bbub04520   Adherens junction bbub04540   Gap junction bbub04550   Signaling pathways regulating pluripotency of stem cells bbub04611   Platelet activation bbub04613   Neutrophil extracellular trap formation bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04625   C-type lectin receptor signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04657   IL-17 signaling pathway bbub04658   Th1 and Th2 cell differentiation bbub04659   Th17 cell differentiation bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04664   Fc epsilon RI signaling pathway bbub04666   Fc gamma R-mediated phagocytosis bbub04668   TNF signaling pathway bbub04713   Circadian entrainment bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04723   Retrograde endocannabinoid signaling bbub04724   Glutamatergic synapse bbub04725   Cholinergic synapse bbub04726   Serotonergic synapse bbub04730   Long-term depression bbub04810   Regulation of actin cytoskeleton bbub04910   Insulin signaling pathway bbub04912   GnRH signaling pathway bbub04914   Progesterone-mediated oocyte maturation bbub04915   Estrogen signaling pathway bbub04916   Melanogenesis bbub04917   Prolactin signaling pathway bbub04919   Thyroid hormone signaling pathway bbub04921   Oxytocin signaling pathway bbub04926   Relaxin signaling pathway bbub04928   Parathyroid hormone synthesis, secretion and action bbub04929   GnRH secretion bbub04930   Type II diabetes mellitus bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04934   Cushing syndrome bbub04935   Growth hormone synthesis, secretion and action bbub04960   Aldosterone-regulated sodium reabsorption bbub05010   Alzheimer disease bbub05020   Prion disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05034   Alcoholism bbub05132   Salmonella infection bbub05133   Pertussis bbub05135   Yersinia infection bbub05140   Leishmaniasis bbub05142   Chagas disease bbub05145   Toxoplasmosis bbub05152   Tuberculosis bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05165   Human papillomavirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05205   Proteoglycans in cancer bbub05206   MicroRNAs in cancer bbub05210   Colorectal cancer bbub05211   Renal cell carcinoma bbub05212   Pancreatic cancer bbub05213   Endometrial cancer bbub05214   Glioma bbub05215   Prostate cancer bbub05216   Thyroid cancer bbub05218   Melanoma bbub05219   Bladder cancer bbub05220   Chronic myeloid leukemia bbub05221   Acute myeloid leukemia bbub05223   Non-small cell lung cancer bbub05224   Breast cancer bbub05225   Hepatocellular carcinoma bbub05226   Gastric cancer bbub05230   Central carbon metabolism in cancer bbub05231   Choline metabolism in cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102396206 (MAPK1)    04012 ErbB signaling pathway     102396206 (MAPK1)    04014 Ras signaling pathway     102396206 (MAPK1)    04015 Rap1 signaling pathway     102396206 (MAPK1)    04350 TGF-beta signaling pathway     102396206 (MAPK1)    04370 VEGF signaling pathway     102396206 (MAPK1)    04371 Apelin signaling pathway     102396206 (MAPK1)    04668 TNF signaling pathway     102396206 (MAPK1)    04066 HIF-1 signaling pathway     102396206 (MAPK1)    04068 FoxO signaling pathway     102396206 (MAPK1)    04072 Phospholipase D signaling pathway     102396206 (MAPK1)    04071 Sphingolipid signaling pathway     102396206 (MAPK1)    04024 cAMP signaling pathway     102396206 (MAPK1)    04022 cGMP-PKG signaling pathway     102396206 (MAPK1)    04151 PI3K-Akt signaling pathway     102396206 (MAPK1)    04150 mTOR signaling pathway     102396206 (MAPK1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102396206 (MAPK1)   09143 Cell growth and death    04114 Oocyte meiosis     102396206 (MAPK1)    04210 Apoptosis     102396206 (MAPK1)    04218 Cellular senescence     102396206 (MAPK1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102396206 (MAPK1)    04520 Adherens junction     102396206 (MAPK1)    04540 Gap junction     102396206 (MAPK1)    04550 Signaling pathways regulating pluripotency of stem cells     102396206 (MAPK1)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102396206 (MAPK1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102396206 (MAPK1)    04613 Neutrophil extracellular trap formation     102396206 (MAPK1)    04620 Toll-like receptor signaling pathway     102396206 (MAPK1)    04621 NOD-like receptor signaling pathway     102396206 (MAPK1)    04625 C-type lectin receptor signaling pathway     102396206 (MAPK1)    04650 Natural killer cell mediated cytotoxicity     102396206 (MAPK1)    04660 T cell receptor signaling pathway     102396206 (MAPK1)    04658 Th1 and Th2 cell differentiation     102396206 (MAPK1)    04659 Th17 cell differentiation     102396206 (MAPK1)    04657 IL-17 signaling pathway     102396206 (MAPK1)    04662 B cell receptor signaling pathway     102396206 (MAPK1)    04664 Fc epsilon RI signaling pathway     102396206 (MAPK1)    04666 Fc gamma R-mediated phagocytosis     102396206 (MAPK1)    04062 Chemokine signaling pathway     102396206 (MAPK1)   09152 Endocrine system    04910 Insulin signaling pathway     102396206 (MAPK1)    04929 GnRH secretion     102396206 (MAPK1)    04912 GnRH signaling pathway     102396206 (MAPK1)    04915 Estrogen signaling pathway     102396206 (MAPK1)    04914 Progesterone-mediated oocyte maturation     102396206 (MAPK1)    04917 Prolactin signaling pathway     102396206 (MAPK1)    04921 Oxytocin signaling pathway     102396206 (MAPK1)    04926 Relaxin signaling pathway     102396206 (MAPK1)    04935 Growth hormone synthesis, secretion and action     102396206 (MAPK1)    04919 Thyroid hormone signaling pathway     102396206 (MAPK1)    04928 Parathyroid hormone synthesis, secretion and action     102396206 (MAPK1)    04916 Melanogenesis     102396206 (MAPK1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102396206 (MAPK1)    04270 Vascular smooth muscle contraction     102396206 (MAPK1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102396206 (MAPK1)   09156 Nervous system    04724 Glutamatergic synapse     102396206 (MAPK1)    04725 Cholinergic synapse     102396206 (MAPK1)    04726 Serotonergic synapse     102396206 (MAPK1)    04720 Long-term potentiation     102396206 (MAPK1)    04730 Long-term depression     102396206 (MAPK1)    04723 Retrograde endocannabinoid signaling     102396206 (MAPK1)    04722 Neurotrophin signaling pathway     102396206 (MAPK1)   09158 Development and regeneration    04360 Axon guidance     102396206 (MAPK1)    04380 Osteoclast differentiation     102396206 (MAPK1)   09159 Environmental adaptation    04713 Circadian entrainment     102396206 (MAPK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102396206 (MAPK1)    05206 MicroRNAs in cancer     102396206 (MAPK1)    05205 Proteoglycans in cancer     102396206 (MAPK1)    05203 Viral carcinogenesis     102396206 (MAPK1)    05230 Central carbon metabolism in cancer     102396206 (MAPK1)    05231 Choline metabolism in cancer     102396206 (MAPK1)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102396206 (MAPK1)   09162 Cancer: specific types    05210 Colorectal cancer     102396206 (MAPK1)    05212 Pancreatic cancer     102396206 (MAPK1)    05225 Hepatocellular carcinoma     102396206 (MAPK1)    05226 Gastric cancer     102396206 (MAPK1)    05214 Glioma     102396206 (MAPK1)    05216 Thyroid cancer     102396206 (MAPK1)    05221 Acute myeloid leukemia     102396206 (MAPK1)    05220 Chronic myeloid leukemia     102396206 (MAPK1)    05218 Melanoma     102396206 (MAPK1)    05211 Renal cell carcinoma     102396206 (MAPK1)    05219 Bladder cancer     102396206 (MAPK1)    05215 Prostate cancer     102396206 (MAPK1)    05213 Endometrial cancer     102396206 (MAPK1)    05224 Breast cancer     102396206 (MAPK1)    05223 Non-small cell lung cancer     102396206 (MAPK1)   09164 Neurodegenerative disease    05010 Alzheimer disease     102396206 (MAPK1)    05020 Prion disease     102396206 (MAPK1)    05022 Pathways of neurodegeneration - multiple diseases     102396206 (MAPK1)   09165 Substance dependence    05034 Alcoholism     102396206 (MAPK1)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102396206 (MAPK1)    04933 AGE-RAGE signaling pathway in diabetic complications     102396206 (MAPK1)    04934 Cushing syndrome     102396206 (MAPK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     102396206 (MAPK1)    05135 Yersinia infection     102396206 (MAPK1)    05133 Pertussis     102396206 (MAPK1)    05152 Tuberculosis     102396206 (MAPK1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102396206 (MAPK1)    05170 Human immunodeficiency virus 1 infection     102396206 (MAPK1)    05161 Hepatitis B     102396206 (MAPK1)    05160 Hepatitis C     102396206 (MAPK1)    05171 Coronavirus disease - COVID-19     102396206 (MAPK1)    05164 Influenza A     102396206 (MAPK1)    05163 Human cytomegalovirus infection     102396206 (MAPK1)    05167 Kaposi sarcoma-associated herpesvirus infection     102396206 (MAPK1)    05165 Human papillomavirus infection     102396206 (MAPK1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102396206 (MAPK1)    05140 Leishmaniasis     102396206 (MAPK1)    05142 Chagas disease     102396206 (MAPK1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102396206 (MAPK1)    01524 Platinum drug resistance     102396206 (MAPK1)    01522 Endocrine resistance     102396206 (MAPK1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:bbub01001]     102396206 (MAPK1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     102396206 (MAPK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102396206 (MAPK1) Enzymes [BR:bbub01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102396206 (MAPK1) Protein kinases [BR:bbub01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102396206 (MAPK1) Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      102396206 (MAPK1) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102396206 (MAPK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like Motif Other DBs NCBI-GeneID:  102396206 NCBI-ProteinID:  XP_025123018 LinkDB All DBs Position 17 AA seq 360 aa AA seqDB search MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc tctgcttatgacaatgtcaacaaagtccgagtcgccatcaagaaaatcagcccttttgag caccagacgtactgccagagaacgctgagagagataaagatcttactgcgcttcagacat gagaacatcatcggaatcaatgacattattcgagcacccaccatcgagcagatgaaagat gtgtatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaagtatatt cattcagccaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccacgaccac acagggttcctgacagagtacgtggccactcgctggtaccgggctccagaaatcatgttg aattccaagggctacaccaagtccatcgacatctggtccgtcggctgcatcctcgccgag atgctctccaacaggcccatcttccccgggaagcattacctcgaccagctgaaccacatt ctgggtattcttggatccccgtcgcaggaagacctgaattgtataataaatttaaaagct agaaactacctgctctctcttccacacaaaaataaggtgccatggaacaggctgttcccg aacgcggactccaaagctctggatctactggacaaaatgttgacgttcaaccctcacaag aggattgaggtggagcaggctctggcccatccttacctggagcagtactacgacccgagc gatgagcccgtcgccgaagcacccttcaagtttgacatggaattggatgacttgcccaag gaaaagctcaaagaactcatttttgaagagactgctagattccagccgggataccgatct taa

Bubalus bubalis (water buffalo): 102403296 Help Entry 102403296         CDS       T05912                                  Gene name MAPK3 Definition (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01521   EGFR tyrosine kinase inhibitor resistance bbub01522   Endocrine resistance bbub01524   Platinum drug resistance bbub04010   MAPK signaling pathway bbub04012   ErbB signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04022   cGMP-PKG signaling pathway bbub04024   cAMP signaling pathway bbub04062   Chemokine signaling pathway bbub04066   HIF-1 signaling pathway bbub04068   FoxO signaling pathway bbub04071   Sphingolipid signaling pathway bbub04072   Phospholipase D signaling pathway bbub04114   Oocyte meiosis bbub04140   Autophagy - animal bbub04150   mTOR signaling pathway bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04218   Cellular senescence bbub04261   Adrenergic signaling in cardiomyocytes bbub04270   Vascular smooth muscle contraction bbub04350   TGF-beta signaling pathway bbub04360   Axon guidance bbub04370   VEGF signaling pathway bbub04371   Apelin signaling pathway bbub04380   Osteoclast differentiation bbub04510   Focal adhesion bbub04520   Adherens junction bbub04540   Gap junction bbub04550   Signaling pathways regulating pluripotency of stem cells bbub04611   Platelet activation bbub04613   Neutrophil extracellular trap formation bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04625   C-type lectin receptor signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04657   IL-17 signaling pathway bbub04658   Th1 and Th2 cell differentiation bbub04659   Th17 cell differentiation bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04664   Fc epsilon RI signaling pathway bbub04666   Fc gamma R-mediated phagocytosis bbub04668   TNF signaling pathway bbub04713   Circadian entrainment bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04723   Retrograde endocannabinoid signaling bbub04724   Glutamatergic synapse bbub04725   Cholinergic synapse bbub04726   Serotonergic synapse bbub04730   Long-term depression bbub04810   Regulation of actin cytoskeleton bbub04910   Insulin signaling pathway bbub04912   GnRH signaling pathway bbub04914   Progesterone-mediated oocyte maturation bbub04915   Estrogen signaling pathway bbub04916   Melanogenesis bbub04917   Prolactin signaling pathway bbub04919   Thyroid hormone signaling pathway bbub04921   Oxytocin signaling pathway bbub04926   Relaxin signaling pathway bbub04928   Parathyroid hormone synthesis, secretion and action bbub04929   GnRH secretion bbub04930   Type II diabetes mellitus bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04934   Cushing syndrome bbub04935   Growth hormone synthesis, secretion and action bbub04960   Aldosterone-regulated sodium reabsorption bbub05010   Alzheimer disease bbub05020   Prion disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05034   Alcoholism bbub05132   Salmonella infection bbub05133   Pertussis bbub05135   Yersinia infection bbub05140   Leishmaniasis bbub05142   Chagas disease bbub05145   Toxoplasmosis bbub05152   Tuberculosis bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05165   Human papillomavirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05205   Proteoglycans in cancer bbub05206   MicroRNAs in cancer bbub05210   Colorectal cancer bbub05211   Renal cell carcinoma bbub05212   Pancreatic cancer bbub05213   Endometrial cancer bbub05214   Glioma bbub05215   Prostate cancer bbub05216   Thyroid cancer bbub05218   Melanoma bbub05219   Bladder cancer bbub05220   Chronic myeloid leukemia bbub05221   Acute myeloid leukemia bbub05223   Non-small cell lung cancer bbub05224   Breast cancer bbub05225   Hepatocellular carcinoma bbub05226   Gastric cancer bbub05230   Central carbon metabolism in cancer bbub05231   Choline metabolism in cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102403296 (MAPK3)    04012 ErbB signaling pathway     102403296 (MAPK3)    04014 Ras signaling pathway     102403296 (MAPK3)    04015 Rap1 signaling pathway     102403296 (MAPK3)    04350 TGF-beta signaling pathway     102403296 (MAPK3)    04370 VEGF signaling pathway     102403296 (MAPK3)    04371 Apelin signaling pathway     102403296 (MAPK3)    04668 TNF signaling pathway     102403296 (MAPK3)    04066 HIF-1 signaling pathway     102403296 (MAPK3)    04068 FoxO signaling pathway     102403296 (MAPK3)    04072 Phospholipase D signaling pathway     102403296 (MAPK3)    04071 Sphingolipid signaling pathway     102403296 (MAPK3)    04024 cAMP signaling pathway     102403296 (MAPK3)    04022 cGMP-PKG signaling pathway     102403296 (MAPK3)    04151 PI3K-Akt signaling pathway     102403296 (MAPK3)    04150 mTOR signaling pathway     102403296 (MAPK3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102403296 (MAPK3)   09143 Cell growth and death    04114 Oocyte meiosis     102403296 (MAPK3)    04210 Apoptosis     102403296 (MAPK3)    04218 Cellular senescence     102403296 (MAPK3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102403296 (MAPK3)    04520 Adherens junction     102403296 (MAPK3)    04540 Gap junction     102403296 (MAPK3)    04550 Signaling pathways regulating pluripotency of stem cells     102403296 (MAPK3)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102403296 (MAPK3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102403296 (MAPK3)    04613 Neutrophil extracellular trap formation     102403296 (MAPK3)    04620 Toll-like receptor signaling pathway     102403296 (MAPK3)    04621 NOD-like receptor signaling pathway     102403296 (MAPK3)    04625 C-type lectin receptor signaling pathway     102403296 (MAPK3)    04650 Natural killer cell mediated cytotoxicity     102403296 (MAPK3)    04660 T cell receptor signaling pathway     102403296 (MAPK3)    04658 Th1 and Th2 cell differentiation     102403296 (MAPK3)    04659 Th17 cell differentiation     102403296 (MAPK3)    04657 IL-17 signaling pathway     102403296 (MAPK3)    04662 B cell receptor signaling pathway     102403296 (MAPK3)    04664 Fc epsilon RI signaling pathway     102403296 (MAPK3)    04666 Fc gamma R-mediated phagocytosis     102403296 (MAPK3)    04062 Chemokine signaling pathway     102403296 (MAPK3)   09152 Endocrine system    04910 Insulin signaling pathway     102403296 (MAPK3)    04929 GnRH secretion     102403296 (MAPK3)    04912 GnRH signaling pathway     102403296 (MAPK3)    04915 Estrogen signaling pathway     102403296 (MAPK3)    04914 Progesterone-mediated oocyte maturation     102403296 (MAPK3)    04917 Prolactin signaling pathway     102403296 (MAPK3)    04921 Oxytocin signaling pathway     102403296 (MAPK3)    04926 Relaxin signaling pathway     102403296 (MAPK3)    04935 Growth hormone synthesis, secretion and action     102403296 (MAPK3)    04919 Thyroid hormone signaling pathway     102403296 (MAPK3)    04928 Parathyroid hormone synthesis, secretion and action     102403296 (MAPK3)    04916 Melanogenesis     102403296 (MAPK3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102403296 (MAPK3)    04270 Vascular smooth muscle contraction     102403296 (MAPK3)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102403296 (MAPK3)   09156 Nervous system    04724 Glutamatergic synapse     102403296 (MAPK3)    04725 Cholinergic synapse     102403296 (MAPK3)    04726 Serotonergic synapse     102403296 (MAPK3)    04720 Long-term potentiation     102403296 (MAPK3)    04730 Long-term depression     102403296 (MAPK3)    04723 Retrograde endocannabinoid signaling     102403296 (MAPK3)    04722 Neurotrophin signaling pathway     102403296 (MAPK3)   09158 Development and regeneration    04360 Axon guidance     102403296 (MAPK3)    04380 Osteoclast differentiation     102403296 (MAPK3)   09159 Environmental adaptation    04713 Circadian entrainment     102403296 (MAPK3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102403296 (MAPK3)    05206 MicroRNAs in cancer     102403296 (MAPK3)    05205 Proteoglycans in cancer     102403296 (MAPK3)    05203 Viral carcinogenesis     102403296 (MAPK3)    05230 Central carbon metabolism in cancer     102403296 (MAPK3)    05231 Choline metabolism in cancer     102403296 (MAPK3)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102403296 (MAPK3)   09162 Cancer: specific types    05210 Colorectal cancer     102403296 (MAPK3)    05212 Pancreatic cancer     102403296 (MAPK3)    05225 Hepatocellular carcinoma     102403296 (MAPK3)    05226 Gastric cancer     102403296 (MAPK3)    05214 Glioma     102403296 (MAPK3)    05216 Thyroid cancer     102403296 (MAPK3)    05221 Acute myeloid leukemia     102403296 (MAPK3)    05220 Chronic myeloid leukemia     102403296 (MAPK3)    05218 Melanoma     102403296 (MAPK3)    05211 Renal cell carcinoma     102403296 (MAPK3)    05219 Bladder cancer     102403296 (MAPK3)    05215 Prostate cancer     102403296 (MAPK3)    05213 Endometrial cancer     102403296 (MAPK3)    05224 Breast cancer     102403296 (MAPK3)    05223 Non-small cell lung cancer     102403296 (MAPK3)   09164 Neurodegenerative disease    05010 Alzheimer disease     102403296 (MAPK3)    05020 Prion disease     102403296 (MAPK3)    05022 Pathways of neurodegeneration - multiple diseases     102403296 (MAPK3)   09165 Substance dependence    05034 Alcoholism     102403296 (MAPK3)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102403296 (MAPK3)    04933 AGE-RAGE signaling pathway in diabetic complications     102403296 (MAPK3)    04934 Cushing syndrome     102403296 (MAPK3)   09171 Infectious disease: bacterial    05132 Salmonella infection     102403296 (MAPK3)    05135 Yersinia infection     102403296 (MAPK3)    05133 Pertussis     102403296 (MAPK3)    05152 Tuberculosis     102403296 (MAPK3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102403296 (MAPK3)    05170 Human immunodeficiency virus 1 infection     102403296 (MAPK3)    05161 Hepatitis B     102403296 (MAPK3)    05160 Hepatitis C     102403296 (MAPK3)    05171 Coronavirus disease - COVID-19     102403296 (MAPK3)    05164 Influenza A     102403296 (MAPK3)    05163 Human cytomegalovirus infection     102403296 (MAPK3)    05167 Kaposi sarcoma-associated herpesvirus infection     102403296 (MAPK3)    05165 Human papillomavirus infection     102403296 (MAPK3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102403296 (MAPK3)    05140 Leishmaniasis     102403296 (MAPK3)    05142 Chagas disease     102403296 (MAPK3)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102403296 (MAPK3)    01524 Platinum drug resistance     102403296 (MAPK3)    01522 Endocrine resistance     102403296 (MAPK3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:bbub01001]     102403296 (MAPK3)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     102403296 (MAPK3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102403296 (MAPK3) Enzymes [BR:bbub01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102403296 (MAPK3) Protein kinases [BR:bbub01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102403296 (MAPK3) Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      102403296 (MAPK3) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102403296 (MAPK3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2 NDUF_B4 Motif Other DBs NCBI-GeneID:  102403296 NCBI-ProteinID:  XP_006070560 LinkDB All DBs Position 24 AA seq 380 aa AA seqDB search MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER LKELIFQETARFQPGVLEAS NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg gtcggcccgggggtcccgggggaggtggagatagtaaaggggcagccgttcgacgtgggc ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct tacgaccacgtgcgcaagactcgagtggccatcaagaaaatcagcccctttgagcatcag acctactgccagcgcacgttgcgagagattcagattctgctgcgcttccgccatgagaat gtcattggcatccgagacattctacgggcacccaccctggaagccatgagggatgtctac atcgtacaggacctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc aacgaccatgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactct gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac cttaagatttgtgatttcggtcttgcccggattgctgatcccgagcatgaccacactggc ttcctgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt attctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac tacctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtcg gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc acagtggaagaagcactggctcacccctacctggagcagtactatgacccaacggatgag ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaggcctcc taa

DBGET integrated database retrieval system