KEGG   Bubalus bubalis (water buffalo): 102396277
Entry
102396277         CDS       T05912                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04015  Rap1 signaling pathway
bbub04310  Wnt signaling pathway
bbub04390  Hippo signaling pathway
bbub04510  Focal adhesion
bbub04520  Adherens junction
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04670  Leukocyte transendothelial migration
bbub04916  Melanogenesis
bbub04919  Thyroid hormone signaling pathway
bbub04934  Cushing syndrome
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05100  Bacterial invasion of epithelial cells
bbub05132  Salmonella infection
bbub05160  Hepatitis C
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05210  Colorectal cancer
bbub05213  Endometrial cancer
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05217  Basal cell carcinoma
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05412  Arrhythmogenic right ventricular cardiomyopathy
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102396277 (CTNNB1)
   04310 Wnt signaling pathway
    102396277 (CTNNB1)
   04390 Hippo signaling pathway
    102396277 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102396277 (CTNNB1)
   04520 Adherens junction
    102396277 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102396277 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102396277 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102396277 (CTNNB1)
   04916 Melanogenesis
    102396277 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102396277 (CTNNB1)
   05205 Proteoglycans in cancer
    102396277 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102396277 (CTNNB1)
   05225 Hepatocellular carcinoma
    102396277 (CTNNB1)
   05226 Gastric cancer
    102396277 (CTNNB1)
   05216 Thyroid cancer
    102396277 (CTNNB1)
   05217 Basal cell carcinoma
    102396277 (CTNNB1)
   05215 Prostate cancer
    102396277 (CTNNB1)
   05213 Endometrial cancer
    102396277 (CTNNB1)
   05224 Breast cancer
    102396277 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102396277 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102396277 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102396277 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102396277 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102396277 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102396277 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    102396277 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102396277 (CTNNB1)
   05163 Human cytomegalovirus infection
    102396277 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102396277 (CTNNB1)
   05165 Human papillomavirus infection
    102396277 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 102396277
NCBI-ProteinID: XP_025128689
LinkDB
Position
21
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggaactggacatggccatggagccagacagaaaagca
gccgtcagtcactggcagcagcagtcttacctggactctggaatccattctggtgccacc
accacagctccttctctgagcggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggaacaggggttttctcagtccttcactcaagaacaagtagct
gatatcgatggacagtatgcaatgactcgagctcagagggtgagagctgctatgttccct
gagacgctagatgagggcatgcagatcccatctacacagtttgatgccgctcatcccact
aacgtccagcgtctggctgaaccatcacagatgctgaaacatgcagttgtaaacttaatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaattgctg
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttcgagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaacacgaacgatgtggagacagctcgctgcactgctgggaccttgcacaat
ctttcccaccatcgtgagggcttgctggccatctttaaatctgggggcattcctgccctg
gtgaagatgctcggttcaccagtggattctgtattgttttatgccattacaactctccac
aaccttttattgcatcaggaaggagctaaaatggccgtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacgaatgttaaattcttggctattacaacagattgt
cttcagattctagcttacggcaatcaagaaagcaagctcatcatcctggctagtggtgga
cctcaagctctagtgaatataatgaggacctacacttatgagaagctactgtggaccaca
agcagagtgctgaaggtgctgtctgtctgctccagtaacaagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcagcgccttgttcagaac
tgcctttggactctaaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggactcttgttcagcttctgggctcagatgatatcaatgtggtcacctgtgca
gctggaattctttctaatctcacttgcaataattataagaacaagatgatggtgtgccaa
gtgggtggcatagaggcccttgtgcgcacggtcctccgtgctggggacagggaagacatc
actgagcctgccatctgtgcccttcgtcatctgaccagccggcaccaggaggctgagatg
gcccagaacgctgttcgccttcactacgggctacctgtggtggttaaactcctacatcca
ccatcccactggcctctgatcaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctttgcgcgagcagggtgccattccacgactagttcagttgctg
gttcgtgcacatcaggatacccagcgtcgtacatctatgggtggaacacagcagcagttt
gtggagggagtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaatcgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcctattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagccgagggagccacagctcctctg
acagaactacttcattctaggaatgagggtgtggcaacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattataagaaacggctttcggttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaacctcttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtgggtacggccaggacgccttggggatggaccccatgatggaacatgagatgggc
ggccaccaccctggtgctgactatccagttgacgggctgccagatctggggcatgcccag
gacctcatggatgggctgcccccaggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system