KEGG   Bubalus bubalis (water buffalo): 102396815Help
Entry
102396815         CDS       T05912                                 

Gene name
SLC16A2
Definition
(RefSeq) monocarboxylate transporter 8
  KO
K08231  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 2
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102396815 (SLC16A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbub02000]
    102396815 (SLC16A2)
Transporters [BR:bbub02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   102396815 (SLC16A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    102396815 (SLC16A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Trypan_PARP
Motif
Other DBs
NCBI-GeneID: 102396815
NCBI-ProteinID: XP_025131730
LinkDB All DBs
Position
X
AA seq 535 aa AA seqDB search
MALQSPASEEAKGPWREADQEQQEPVGSPEPEPEPVPVPPPEPQPEPQPEPQPLPDPAPL
PELEFEPEPMHEPDPTPTVETRGTARGFQPPEGGFGWMVVFAATWCNGSIFGIQNSFGIL
YSMLLQEEREKNRQVEFQAAWVGALSMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIG
LHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSI
SFPLLIKTLGAKIKLAQTFQVLSTFMFILTLLSLTYRPLLPSSQDTPSKRGVHTLCQRFL
AQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFLEIKQTWVLLVCIG
ATSGLGRLVSGRVSDSIPGLKKIYLQVISFLLLGLMSMMIPLCRGFGGLIVVCLFLGLCD
GFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAG
VPPIVGAVILLFVPLMHQRMFKKEQRDSSKDKMLTPDPDPNGELLPGSSTPEEPI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcaaagcccggcgagcgaggaagctaaagggccctggcgggaggcagaccag
gaacagcaggagccagtgggtagccccgagccggagccggagccagtgccagtgccccca
cccgagccccagccagaacctcagccggagccccagcccctaccggaccctgcaccgctg
ccggagctggagtttgagcctgagccgatgcacgaacccgaccctacacccacggtggag
acccgcggcaccgcgcgtggcttccagccccccgaaggtggcttcggctggatggtggtc
ttcgctgccacctggtgcaacggctccatcttcggcatccagaactccttcgggattctt
tactccatgctgctgcaggaggaaagagagaaaaatcgccaagtggagttccaagcagca
tgggtaggagccctgtcaatgggaatgatcttcttctgttctcccattgtgagtatattc
actgatcgtttgggctgccgaatcacagcaactgcaggggctgctgttgctttcattggc
ctccataccagctccttcaccagctcactaagcctgcgctacttcacctatgggattctc
tttggttgtggctgttccttcgcctttcagccatctctcgtcatcctgggccattacttc
caacgccgtctgggtctggccaatggtgtggtgtctgctgggagtagcatcttctccata
tccttccccctcctcatcaaaacactgggggctaagatcaagctcgctcaaaccttccag
gtgctgagtacctttatgtttattcttacgctgctttcactcacctaccgacccctcctg
ccgagctcgcaagacaccccaagcaagagaggtgtccacaccctgtgccaacgctttctg
gctcagctcaggaagtacttcaacatgcgagtgttccgccaacgtacctaccgcatctgg
gccttcgggatcgctgctgctgcccttggctacttcgttccctatgtacacctgatgaag
tatgtggaagaggaattcttggaaatcaagcagacctgggtgctcttggtgtgtattggg
gctacctcaggccttgggcgccttgtttcaggccgtgtcagtgactccattcctggactt
aagaagatctacttgcaggtcatctccttcttgctcctgggcctgatgtccatgatgatt
cccctctgccggggcttcgggggcctcatcgttgtctgcctcttcctgggcctgtgcgat
ggcttcttcatcaccatcatggcccccatcgcatttgagctggtgggcccaatgcaggcc
tcacaggccattggctacctcctgggtatgatggccctgccgatgattgccggacccccc
attgcaggcctcctccgcaactgttttggggactatcatgtggccttctactttgccggt
gtacccccaatcgttggggcagtaatcctcttgttcgtccctctgatgcatcaaaggatg
ttcaagaaagagcaaagggattccagcaaggataagatgctgacccctgacccagacccc
aatggagagctgctgccgggctcctctacccctgaggaaccaatctaa

DBGET integrated database retrieval system