KEGG   Bubalus bubalis (water buffalo): 102397131
Entry
102397131         CDS       T05912                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04151  PI3K-Akt signaling pathway
bbub04630  JAK-STAT signaling pathway
bbub04640  Hematopoietic cell lineage
bbub04657  IL-17 signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub04660  T cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04672  Intestinal immune network for IgA production
bbub05140  Leishmaniasis
bbub05200  Pathways in cancer
bbub05310  Asthma
bbub05320  Autoimmune thyroid disease
bbub05321  Inflammatory bowel disease
bbub05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102397131 (IL4)
   04151 PI3K-Akt signaling pathway
    102397131 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102397131 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102397131 (IL4)
   04660 T cell receptor signaling pathway
    102397131 (IL4)
   04658 Th1 and Th2 cell differentiation
    102397131 (IL4)
   04659 Th17 cell differentiation
    102397131 (IL4)
   04657 IL-17 signaling pathway
    102397131 (IL4)
   04664 Fc epsilon RI signaling pathway
    102397131 (IL4)
   04672 Intestinal immune network for IgA production
    102397131 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102397131 (IL4)
  09163 Immune disease
   05310 Asthma
    102397131 (IL4)
   05320 Autoimmune thyroid disease
    102397131 (IL4)
   05321 Inflammatory bowel disease
    102397131 (IL4)
   05330 Allograft rejection
    102397131 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102397131 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102397131 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:bbub00536]
    102397131 (IL4)
Cytokines and growth factors [BR:bbub04052]
 Cytokines
  Interleukins
   102397131 (IL4)
Glycosaminoglycan binding proteins [BR:bbub00536]
 Heparan sulfate / Haparin
  Cytokines
   102397131 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 102397131
NCBI-ProteinID: NP_001277888
UniProt: A4GRD9
LinkDB
Position
9
AA seq 135 aa
MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP
KNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL
LERLKTIMKEKYSKC
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgatcccagtgctggtctgcttactggtatgtaccagtcac
ttcgtccatggacacaagtgcgatattaccttagcagagatcatcaaaacgctgaacatc
ctcacaacgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca
aagaacacaactgagaaggaaaccttctgcagggttggaattgagcttaggcgtatctac
aggagccacacgtgcttgaacaaattcctgggcggactcgacaggaatctcaacagcttg
gcaagcaagacctgttctgtgaatgaagccaagacgagcacaagtacgctgaaagacctc
ttggaaaggctaaagacgattatgaaggagaaatactccaagtgttga

DBGET integrated database retrieval system