KEGG   Bubalus bubalis (water buffalo): 102397143Help
Entry
102397143         CDS       T05912                                 

Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04217  Necroptosis
bbub04621  NOD-like receptor signaling pathway
bbub04623  Cytosolic DNA-sensing pathway
bbub04625  C-type lectin receptor signaling pathway
bbub05132  Salmonella infection
bbub05133  Pertussis
bbub05134  Legionellosis
bbub05135  Yersinia infection
bbub05164  Influenza A
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102397143
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102397143
   04623 Cytosolic DNA-sensing pathway
    102397143
   04625 C-type lectin receptor signaling pathway
    102397143
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102397143
   05135 Yersinia infection
    102397143
   05133 Pertussis
    102397143
   05134 Legionellosis
    102397143
  09172 Infectious disease: viral
   05164 Influenza A
    102397143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PYRIN HK_sensor
Motif
Other DBs
NCBI-GeneID: 102397143
NCBI-ProteinID: XP_006070447
LinkDB All DBs
Position
24
AA seq 195 aa AA seqDB search
MGCTRDAILDALENLTADEFKKFKMKLLSVPLREGYGRIPRGTLLPLDAVDLTDKLVSYY
LEAYGAELTALVLRDMGMQEVAEQLQETMSKGPRNVLAEVRAPLQKTAKPGLHFVDQHRA
ALIARVTVVDGVLDALYGKVLTEEQYQAVRAERTSSDKMRKLFSFAPAWNMTCKDLLLQA
LRDTQPYLVDDLEQS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcacacgcgatgccatcctggatgcgctagagaacctgacagcggacgagttc
aaaaagttcaagatgaagctgctttcagtgccgctgcgggaaggctatggacgcatcccc
cgggggaccctgctgccactggacgccgtggacctcaccgacaagctcgtcagctactat
ctggaggcgtacggtgccgagctcacggcgcttgtgcttcgcgacatgggcatgcaggaa
gtggcggagcagctgcaggagaccatgagcaagggccctagaaacgtgctagccgaggtc
agggcccctctccagaagacagccaagccaggactgcactttgtggaccagcatcgggcg
gccctcatcgcacgggtcacagtcgtggatggggtgctggatgccctgtatgggaaggtc
ctgacagaggagcagtaccaggcagtgcgggcggaacgcactagttcggacaagatgagg
aagctcttcagctttgctccagcctggaacatgacctgcaaggatctgctcctccaggcg
ctgagggacacccagccctacctggtggacgacctggagcagagctga

DBGET integrated database retrieval system