KEGG   Bubalus bubalis (water buffalo): 102397938
Entry
102397938         CDS       T05912                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01523  Antifolate resistance
bbub04010  MAPK signaling pathway
bbub04014  Ras signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04064  NF-kappa B signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04137  Mitophagy - animal
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04211  Longevity regulating pathway
bbub04218  Cellular senescence
bbub04380  Osteoclast differentiation
bbub04620  Toll-like receptor signaling pathway
bbub04621  NOD-like receptor signaling pathway
bbub04622  RIG-I-like receptor signaling pathway
bbub04623  Cytosolic DNA-sensing pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04657  IL-17 signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04668  TNF signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04917  Prolactin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04926  Relaxin signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05030  Cocaine addiction
bbub05132  Salmonella infection
bbub05133  Pertussis
bbub05134  Legionellosis
bbub05135  Yersinia infection
bbub05140  Leishmaniasis
bbub05142  Chagas disease
bbub05145  Toxoplasmosis
bbub05146  Amoebiasis
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05203  Viral carcinogenesis
bbub05212  Pancreatic cancer
bbub05215  Prostate cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05222  Small cell lung cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05321  Inflammatory bowel disease
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102397938 (RELA)
   04014 Ras signaling pathway
    102397938 (RELA)
   04064 NF-kappa B signaling pathway
    102397938 (RELA)
   04668 TNF signaling pathway
    102397938 (RELA)
   04066 HIF-1 signaling pathway
    102397938 (RELA)
   04071 Sphingolipid signaling pathway
    102397938 (RELA)
   04024 cAMP signaling pathway
    102397938 (RELA)
   04151 PI3K-Akt signaling pathway
    102397938 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102397938 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102397938 (RELA)
   04218 Cellular senescence
    102397938 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102397938 (RELA)
   04621 NOD-like receptor signaling pathway
    102397938 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102397938 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102397938 (RELA)
   04625 C-type lectin receptor signaling pathway
    102397938 (RELA)
   04660 T cell receptor signaling pathway
    102397938 (RELA)
   04658 Th1 and Th2 cell differentiation
    102397938 (RELA)
   04659 Th17 cell differentiation
    102397938 (RELA)
   04657 IL-17 signaling pathway
    102397938 (RELA)
   04662 B cell receptor signaling pathway
    102397938 (RELA)
   04062 Chemokine signaling pathway
    102397938 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102397938 (RELA)
   04917 Prolactin signaling pathway
    102397938 (RELA)
   04926 Relaxin signaling pathway
    102397938 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102397938 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102397938 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    102397938 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102397938 (RELA)
   05202 Transcriptional misregulation in cancer
    102397938 (RELA)
   05203 Viral carcinogenesis
    102397938 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102397938 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102397938 (RELA)
   05221 Acute myeloid leukemia
    102397938 (RELA)
   05220 Chronic myeloid leukemia
    102397938 (RELA)
   05215 Prostate cancer
    102397938 (RELA)
   05222 Small cell lung cancer
    102397938 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102397938 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102397938 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    102397938 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102397938 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102397938 (RELA)
   04931 Insulin resistance
    102397938 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102397938 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102397938 (RELA)
   05135 Yersinia infection
    102397938 (RELA)
   05133 Pertussis
    102397938 (RELA)
   05134 Legionellosis
    102397938 (RELA)
   05152 Tuberculosis
    102397938 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102397938 (RELA)
   05170 Human immunodeficiency virus 1 infection
    102397938 (RELA)
   05162 Measles
    102397938 (RELA)
   05164 Influenza A
    102397938 (RELA)
   05161 Hepatitis B
    102397938 (RELA)
   05160 Hepatitis C
    102397938 (RELA)
   05168 Herpes simplex virus 1 infection
    102397938 (RELA)
   05163 Human cytomegalovirus infection
    102397938 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102397938 (RELA)
   05169 Epstein-Barr virus infection
    102397938 (RELA)
   05165 Human papillomavirus infection
    102397938 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102397938 (RELA)
   05145 Toxoplasmosis
    102397938 (RELA)
   05140 Leishmaniasis
    102397938 (RELA)
   05142 Chagas disease
    102397938 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102397938 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102397938 (RELA)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102397938 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102397938
NCBI-ProteinID: XP_006056522
LinkDB
Position
5
AA seq 551 aa
MDDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPYSFTPSLSTINF
EEFSPMVFSSGQIPSQTSALAPAPTPVLTQTQVLAPAPAPAPGMSSTLAQALAPGLAQAV
TPPAPKTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ
GVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADV
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgacctcttccccctcatcttccccgcagagccggcgcaggcctctggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgtgagggc
cgctcagctggcagcatccctggagagaggagcacggacaccaccaagacccaccccact
atcaagatcaatggctacacagggccagggacagtccgcatctccctggtcaccaaggac
ccccctcaccggcctcacccccacgagctagtggggaaagactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagctttcagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagccagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgcggggactacgacctgaatgctgtccggctctgc
ttccaggtgacagtgcgggacccagcaggcaggcccctccgcctggcgcctgtcctctct
caccccatctttgacaaccgcgcccccaacaccgccgagctcaagatctgccgggtgaat
cggaactctgggagctgcctcggcggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaggtgtatttcacggggccaggctgggaggcccgaggctcgttttca
caagctgacgtgcaccggcaagtggccatcgtgttccggacgccgccctacgcggacccc
ggcctgcaggcccctgtgcgcgtctccatgcagctgcggcggccttccgatcgcgagctc
agcgagcccatggaattccagtacttgccagacacagacgatcgtcaccggattgaggag
aagcgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagccctttcaatgga
cccaccgacccccggcctccgacccggcgcatcgctgtgcctaaccgtggctcagcctcc
atccccaagccagctccccagccctattcctttacgccatctctcagcaccatcaacttt
gaggagttttcccccatggtcttttcttctgggcagatcccaagccagacctcggccttg
gcaccagcccccaccccggtcctgacccagacccaagtcctggccccagccccggcccca
gccccaggcatgtcatcaaccctggcccaggccctagccccaggcctggctcaggctgtg
accccgcctgcccccaagaccaaccagaccggggaagggacactgacagaggccctgctg
cagctgcagtttgataccgatgaagacctgggggctctgcttggcaacaacactgaccct
gccgtgttcacagacctggcatctgtcgacaactctgagtttcagcagttgctgaaccag
ggtgtacccatgggcccccacacagctgagcccatgctgatggagtaccctgaggctata
actcgcctggtgacagggtcccaaaggccccctgacccagctcccactcccctggggccc
cctgggctcaccaatggcctcctctcgggggatgaagacttctcctccatcgcagacgtg
gacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system