KEGG   Bubalus bubalis (water buffalo): 102398474Help
Entry
102398474         CDS       T05912                                 

Gene name
PCK2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [GTP], mitochondrial isoform X1
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00020  Citrate cycle (TCA cycle)
bbub00620  Pyruvate metabolism
bbub01100  Metabolic pathways
bbub03320  PPAR signaling pathway
bbub04068  FoxO signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04964  Proximal tubule bicarbonate reclamation
Module
bbub_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102398474 (PCK2)
   00020 Citrate cycle (TCA cycle)
    102398474 (PCK2)
   00620 Pyruvate metabolism
    102398474 (PCK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102398474 (PCK2)
   04151 PI3K-Akt signaling pathway
    102398474 (PCK2)
   04152 AMPK signaling pathway
    102398474 (PCK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102398474 (PCK2)
   04922 Glucagon signaling pathway
    102398474 (PCK2)
   04920 Adipocytokine signaling pathway
    102398474 (PCK2)
   03320 PPAR signaling pathway
    102398474 (PCK2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102398474 (PCK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102398474 (PCK2)
Enzymes [BR:bbub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     102398474 (PCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_GTP PEPCK_N
Motif
Other DBs
NCBI-GeneID: 102398474
NCBI-ProteinID: XP_025151906
LinkDB All DBs
Position
11
AA seq 660 aa AA seqDB search
MAAMYRPGLRLSWHRLSPWGWSSRCSIQTLRVLSGDLGQLPAKVRDFVEHSARLCQPEGI
HICDGTEAENTATLALLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPAGGARGQLGNWMSPAEFQQAVDERFPGCMQGRTMYVIPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQAPDTLMPDAPASSPMNPLS
PGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLA
EHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSDGR
LRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVT
VTSWLGKPWKPGDKEPCAHPNSRFCAPARQCPIIDPAWEAPEGVPIDAIIFGGRRPKGVP
LVYEAFNWRHGVFVGSAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGRYLEHWLSMDG
RKGVRLPRIFHVNWFRRDEAGRFLWPGFGENARVLDWICRRLDGEDSARETPIGLVPKEG
ALDLSSLGAIDTTQLFSLPKDFWQQEVHDIRSYLTEQVNQDLPKEVLAELEALEGRVRRM
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggccgctatgtaccgccccggcctgcggcttagctggcacaggctgagcccctggggt
tggtcgtcacggtgtagcatccagacgctgcgagtcctcagcggagatctgggccaactg
cctgctaaggttcgagactttgtggagcacagtgcccgcctgtgccaaccagagggcatc
cacatctgtgatgggactgaggcggagaacactgccacactggccctgctggaacagcag
ggactcatccgaaaactcccgaagtacaacaattgctggctggcccgcacagaccccaag
gatgtggcacgagtagagagcaagacggtgattgtaactccttctcaacgggacacggtg
cccctcccggctggtggggcccgtgggcagctgggcaactggatgtccccagctgagttc
cagcaagctgtggatgagaggtttccaggctgcatgcagggccgaaccatgtacgtgatt
ccgttcagcatgggtcccgtgggctccccactgtcccgcatcggagtgcagctcacggac
tctgcctacgtggtggcaagcatgcggattatgactcggctggggacacctgtgctccag
gccctgggagatggcgactttgtcaagtgtcttcactctgtgggccaacccttgactggg
caagcccctgacaccctgatgcctgatgcccctgccagcagccccatgaatccattgtcc
ccaggggagccggtgagccagtggccatgcaatccagagaaaaccctgattggccacgtg
cctgaccagcgggagatcatctccttcggcagcggctatggtggcaactccctgctgggc
aagaagtgctttgcccttcgcatcgcctctcggctggcccgggatgagggctggctggcg
gagcacatgctgatcctgggtatcaccaatccagcagggaagaagcgctatgtggcagcc
gccttccccagtgcttgtggcaagacaaacctggccatgatgcggccagcactgccaggc
tggaaagtggagtgtgtgggggatgacattgcctggatgaggtttgacagtgatggtcga
ctccgggccatcaaccctgagaatggcttctttggggtggcccctggcacctctgccacc
accaatcccaatgctatggccacaatccagagtaacaccattttcaccaacgtggctgag
accagcgatggcggtgtgtactgggagggcattgatcagcctcttccacctggcgtcacc
gtgacctcctggctaggcaaaccctggaaacctggtgacaaggagccctgtgcgcatccc
aactctcgcttttgtgccccggctcgccagtgccccatcatagaccccgcctgggaggcc
ccagagggagtccccattgacgccatcatctttggaggccgtagacccaaaggagtcccc
ctggtatatgaggccttcaactggcgccacggggtgtttgtgggcagtgccatgcgctcc
gaggccactgcagcagctgaacacaaagggaaggtcatcatgcatgacccatttgccatg
cggccgtttttcggctacaactttgggcgctaccttgaacactggctgagcatggacggg
cgcaagggggtccggctgccccgcatcttccatgtcaactggttccggcgtgacgaggca
ggccgcttcctgtggccaggctttggagagaatgcccgggtgctagactggatctgccga
cggcttgacggggaggacagtgcccgagagacacccatcgggctggtgcctaaggaaggc
gccttggatctcagcagcctgggagccatagacaccacccagttgttctccctccccaag
gacttttggcaacaggaggttcatgacattcggagctatctgacagagcaggtcaaccag
gatctgcccaaggaagtgctggctgagctggaggccctggagggacgtgtgcgcagaatg
tga

KEGG   Bubalus bubalis (water buffalo): 102401675Help
Entry
102401675         CDS       T05912                                 

Gene name
PCK1
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00010  Glycolysis / Gluconeogenesis
bbub00020  Citrate cycle (TCA cycle)
bbub00620  Pyruvate metabolism
bbub01100  Metabolic pathways
bbub03320  PPAR signaling pathway
bbub04068  FoxO signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04152  AMPK signaling pathway
bbub04910  Insulin signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04964  Proximal tubule bicarbonate reclamation
Module
bbub_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102401675 (PCK1)
   00020 Citrate cycle (TCA cycle)
    102401675 (PCK1)
   00620 Pyruvate metabolism
    102401675 (PCK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102401675 (PCK1)
   04151 PI3K-Akt signaling pathway
    102401675 (PCK1)
   04152 AMPK signaling pathway
    102401675 (PCK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102401675 (PCK1)
   04922 Glucagon signaling pathway
    102401675 (PCK1)
   04920 Adipocytokine signaling pathway
    102401675 (PCK1)
   03320 PPAR signaling pathway
    102401675 (PCK1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102401675 (PCK1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102401675 (PCK1)
Enzymes [BR:bbub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     102401675 (PCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_GTP PEPCK_N CSTF_C
Motif
Other DBs
NCBI-GeneID: 102401675
NCBI-ProteinID: XP_025119534
LinkDB All DBs
Position
14
AA seq 622 aa AA seqDB search
MPPQLSDGLNYSAKIVRGSLDSLPQAVREFVESSAKLCRPDQVHICDGSEEENRQLLSHM
EEEGVIKRLKKYDNCWLALTDPRDVARIESKTVIITREQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNVRFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVTSMRIMTRMGTSV
LEALGDGEFVKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPKGQKKYFAAAFPSACGKTNLAMMNPTL
PGWKVECVGDDIAWMKFDQQGNLRAINPENGFFGVAPGTSVRTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDQPLASGIKLISWKGKEWDPKDGEPCAHPNSRFCTPASQCPIIDPDW
ESPEGVPIEGIIFGGRRPVGVPLVYEALSWQHGVFVGAAMRSEATAAAEYKGKVIMHDPF
AMRPFFGYNFGQYLAHWLSMAQRPAAKLPKIFHVNWFRKDKAGRFLWPGFGENSRVLEWM
FNRVAGEGGAKLTPIGYIPSEDALDLRGLGDVDVKELFHISKEFWEEEVEEIQKYLEEQV
NVDLPPEIKNQVLALKQRISQM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcagctctcagacggcctcaactactcagccaaaatcgtccggggctccctg
gacagcctgccccaggccgtgagggagtttgtggagagcagcgccaagctgtgccggccc
gaccaagtccacatctgcgatggctctgaggaggagaaccggcagctgctgagccacatg
gaggaggagggtgtgatcaagaggctgaagaagtatgacaactgctggttggctctcact
gaccccagggatgtggccagaattgaaagcaagacggtcatcatcactcgagagcaaaga
gatacggtgcccatccccaaaaccggcctcagccagctgggccgctggatgtccgaggag
gattttgagaaagcattcaacgtccgatttccggggtgcatgaagggtcgcaccatgtat
gtcatcccattcagcatggggcccctgggctctcctctgtccaagattggcatcgagctg
acagactcgccctacgtggtgaccagcatgcgcatcatgacgaggatgggcaccagcgtc
ctggaagcgctgggggacggcgagttcgtcaagtgcctccactccgtggggtgccctttg
cctttaaaaaagcctttggttaacaactgggcctgtaaccccgagctcacactcatcgcc
cacctgcccgaccgccgagaaatcatctcctttgggagtgggtacggcgggaactcgctc
cttgggaagaagtgctttgccctcaggatggccagccggctggccaaggaggaggggtgg
ctggcagagcacatgctgattctgggcatcaccaaccccaagggccagaagaagtacttc
gcggctgcatttcccagcgcctgtgggaagaccaacctggccatgatgaaccctactctc
ccgggatggaaagtagagtgtgtgggtgatgatatcgcctggatgaaatttgaccaacaa
ggtaacttgcgggccatcaatccagagaatgggttttttggcgtcgctccgggaacctct
gtgaggacaaatcccaacgccatcaagaccatccagaagaataccatcttcaccaatgtg
gccgagaccagtgatgggggcgtttactgggaaggcattgaccagccgctggcctcaggc
atcaagctcatttcctggaagggcaaggagtgggacccaaaggatggggagccttgtgcc
catcccaactcacggttctgcactccggccagccagtgccccatcattgaccctgactgg
gagtctccagagggcgtgcccattgagggcatcatctttggagggcgccggcctgttggt
gtccctctggtctacgaggctctcagctggcagcacggtgtgtttgtgggggcagccatg
agatctgaggccacggcagcggcggagtacaagggcaaagtcatcatgcacgaccccttc
gccatgcgccccttctttggctacaacttcggccagtacctggcacactggctcagcatg
gcccagcgccccgcagccaagctgcccaagatcttccatgtcaactggttccgaaaggac
aaggccggcaggttcctctggcccggcttcggcgagaactcccgggtgctggagtggatg
ttcaaccgtgtggcgggggaaggcggcgccaagctcacgcccatcggctacatccccagt
gaggatgccctggacctccggggcctgggggatgtcgacgtgaaggagctcttccacatc
tccaaggagttctgggaggaggaggtggaggaaatacagaagtaccttgaggagcaagtg
aacgtcgatctacccccggagatcaagaatcaggtcctggccctgaagcagagaatcagc
cagatgtaa

DBGET integrated database retrieval system