KEGG   Bubalus bubalis (water buffalo): 102399070
Entry
102399070         CDS       T05912                                 

Gene name
SLC44A5
Definition
(RefSeq) choline transporter-like protein 5 isoform X1
  KO
K15377  solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102399070 (SLC44A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbub02000]
    102399070 (SLC44A5)
   04147 Exosome [BR:bbub04147]
    102399070 (SLC44A5)
Transporters [BR:bbub02000]
 Solute carrier family (SLC)
  SLC44: Choline-like transporter
   102399070 (SLC44A5)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   102399070 (SLC44A5)
SSDB
Motif
Pfam: Choline_transpo SNAD4
Other DBs
NCBI-GeneID: 102399070
NCBI-ProteinID: XP_025144224
LinkDB
Position
6
AA seq 728 aa
MAKKRKPPSIKGDQRSDTHLEGEKYGTPRAYDPHFRGPVVNRSCTDVLCCMIFILFIMAY
ILLGLAAWVNGDPRRVAYPTDSQGYFCGQKGTPNENKSILFYFNLLTCTSPSVVVNLQCP
TTQICVSKCPERFLTYMEIQFKYKNDSEYWTYYSQFCRTTFLKPAETLSQVLLDNDCPSA
IYPSKPFLQRCFPDFSTKNGTLTVGNKTVFDDGNGKTRNAAELRRAANGINKALDARAIG
VKVFEDYAMTWYWILIGLTIAMFLSWMFVMLLRFTAGLLFWIFTFGVIGIIAYGIWRCYL
EYSRLQEQPSSHLNAYSIGIQTDISMYFRLKQTWFALMIILCLLELFIILMLIFLRNRIR
ISIALLKEGSKAIGYIPSTLIYPALTFFFLSVCISYWAVVALYLATSGAPIYKVIAPQGQ
CEHENKTCDPVGFNTTEIAKACPGAQCHFAFYGGKSLYHQYITTFQLLNLFVFLWLINFV
IALGQCALAGAFASYYWALKKPDDIPPYPLFTAFGRAIRYHTGSLAFGSLILAIIQMFRL
ILEYLDKRLQEAQSNISKFLKCCLRCCFWCLEKAVKFLNRNAYVMMAIYGKNFCKSARDA
FNLLMRNILKIAVMDRVTDFVLILGKILVAGCIGVLAFLLFTERLPVIIEGPTSLNYYWV
PLLTVIIGSYIIAHGFFSVYAMCIETIFICFCEDLERNDGSTEKPYFITPTLHGILNKKQ
LVPQKQKK
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggccaagaagagaaagccccccagcatcaagggagaccaacgatcagatactcacttg
gagggcgagaaatatggtactccaagggcatatgatccgcatttcagaggacccgttgtc
aacaggagttgtacagatgtgctgtgctgcatgatcttcatactgttcattatggcctac
attcttttaggacttgcagcctgggtcaatggtgaccccagaagagtggcctatcctaca
gacagccagggctacttttgtggccagaagggcacccccaatgagaacaagtccattttg
ttttactttaacctgctcacctgtaccagtccctccgtggtggtaaacctacagtgccct
accacacagatctgtgtctccaagtgcccagaaagatttttaacttacatggaaatacaa
tttaagtacaaaaacgacagtgaatactggacatactacagccagttctgccggactact
tttcttaagcctgcggagactctctcacaagttttactggataatgattgtccatcagcg
atttatccaagcaaaccttttctccagagatgtttcccagacttctctactaaaaatggc
actttaacagtaggaaataagacagtgtttgatgatggaaatggaaagacaagaaatgct
gcagaactcagaagagctgcaaatggtatcaataaagcccttgatgcaagggcaattgga
gtgaaggtgtttgaagactatgcaatgacatggtattggattctcattggcctgactatc
gccatgttcctcagctggatgtttgtgatgctcctgaggttcacagctggattgcttttc
tggatcttcacctttggtgtgattggaatcatagcttatggaatatggcgctgttaccta
gaatacagccgtcttcaggaacagccaagttctcacttaaatgcatattccattgggatt
cagactgacataagcatgtactttcgcctgaaacaaacatggttcgcacttatgataata
ctctgcctccttgaactgttcatcatcctcatgctgatcttcctcaggaaccgaatccgt
atctccatcgccctgctgaaggaggggagcaaagccattggatacatccctagtacttta
atttatccagctttaactttctttttcctctcagtctgcatttcctactgggctgtggta
gcactttacttggctacatcaggggcaccaatatacaaagtcatagccccacagggccaa
tgtgaacatgaaaataaaacctgtgacccagtgggttttaatacaactgaaattgccaaa
gcttgccctggggctcagtgtcattttgctttctatggtggaaagagcctatatcatcaa
tacatcactaccttccagttactcaatctattcgtctttctctggcttataaactttgtc
attgcattgggtcagtgtgcccttgctggtgcctttgcttcttattattgggccttgaaa
aaacctgatgacatcccaccctatccactttttactgcatttggacgagccataagatat
cacacaggatccctagcatttggatctttaattcttgcaataattcaaatgttcagatta
atcctagaatacttggacaaacgtcttcaagaggcccagagcaacatttctaaattccta
aaatgctgcctgagatgctgtttctggtgtttggaaaaagcagtaaagtttttgaacaga
aatgcctatgttatgatggcaatatacggcaaaaacttctgcaagtcagcaagagatgct
ttcaatctgctgatgagaaatattttaaaaattgcagttatggatagagtgacagacttt
gtactaatcctgggaaagattctagttgctggctgtataggtgtcctggccttcctgctt
ttcaccgaaagactcccagtgattatagaaggaccaacatctttaaattactactgggta
cctttgctgacagtgattattggatcttacataattgcacatggattcttcagcgtctat
gcaatgtgtattgaaacaattttcatctgcttctgtgaagatctggaaagaaatgatgga
tcaacagaaaaaccctacttcataacccctaccctgcacggaattctgaacaagaagcaa
ctagttccccagaagcagaaaaagtag

DBGET integrated database retrieval system