KEGG   Bubalus bubalis (water buffalo): 102399331Help
Entry
102399331         CDS       T05912                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04152  AMPK signaling pathway
bbub04211  Longevity regulating pathway
bbub04380  Osteoclast differentiation
bbub04714  Thermogenesis
bbub05016  Huntington disease
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102399331 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102399331 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102399331 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    102399331 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    102399331 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102399331 (PPARG)
   05202 Transcriptional misregulation in cancer
    102399331 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    102399331 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102399331 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102399331 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bbub03310]
    102399331 (PPARG)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    102399331 (PPARG)
Nuclear receptors [BR:bbub03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   102399331 (PPARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Motif
Other DBs
NCBI-GeneID: 102399331
NCBI-ProteinID: NP_001277822
UniProt: H2DQS9
LinkDB All DBs
Position
21
AA seq 475 aa AA seqDB search
MVDTEMPFWPTNFGISSVDLSMMDDHSHAFDIKPFTTVDFSSISTPHYEDIPFPRADPMV
ADYKYDLKLQEYQSAIKVEPVSPPYYSEKTQLYSKPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHISPLQEPSKEVAIRIFQGCQFRSVEAVQEITEYAKN
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVAEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggttgacacagagatgccgttttggcccaccaactttgggatcagctccgtggacctt
tctatgatggatgatcactcccatgcctttgacatcaagcccttcaccaccgttgacttc
tccagcatttccactccgcactatgaggacattccgttcccaagagctgacccgatggtt
gcagattataagtatgacctgaagctccaagagtaccaaagtgcaatcaaagtggagcct
gtatccccaccttattattctgaaaagactcagctgtacagtaagcctcatgaagagcct
tccaactccctcatggccattgaatgccgggtctgtggggataaagcgtcagggttccac
tatggagttcatgcttgtgaaggatgcaagggtttcttccggaggacaatcagattgaaa
cttatttacgataggtgtgatcttaactgtcggatccacaagaaaagtagaaataaatgt
cagtactgtcggtttcagaagtgccttgctgtggggatgtctcataatgccatcaggttt
gggcgcatgccacaggccgagaaggagaagctgttagcggagatctccagcgatatcgac
caactgaacccagagtctgctgacctccgggccctggcaaagcatttgtatgactcgtac
ataaagtccttcccgctgaccaaagcaaaggcgagggcgatcttgacgggaaagacgaca
gacaaatcaccgtttgttatctatgacatgaactccttaatgatgggagaagataaaatc
aagttcaagcacatcagtcccctgcaggagcccagcaaagaggtggccatccgcatcttc
caggggtgtcagtttcgctccgtggaagccgtgcaggagatcacagagtacgccaagaat
atccccggctttgtgaaccttgacttgaacgaccaagtaactctcctaaaatacggcgtg
cacgagatcatttacacgatgctggcctccttgatgaataaggatggggtcctcatatcc
gagggccaaggattcatgacaagggagtttctaaagagcctgcgaaagccctttggtgac
tttatggagcccaagttcgagtttgctgtgaagttcaacgcactggaattagatgacagc
gacttagcaatatttatagctgtcattattctcagtggagaccgcccaggtttgctgaac
gtgaagcccattgaggacatacaagacaatctgctgcaagccttggagctgcagctcaag
ctgaaccaccccgagtcctcccagctctttgccaagctgctccagaaaatgacagacctc
agacagattgtagcagaacacgtgcagctgttgcaagtaataaagaaaacagagacggac
atgagtctccacccactcctacaggaaatctacaaggacttgtattag

DBGET integrated database retrieval system