KEGG   Bubalus bubalis (water buffalo): 102399521
Entry
102399521         CDS       T05912                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01524  Platinum drug resistance
bbub04071  Sphingolipid signaling pathway
bbub04115  p53 signaling pathway
bbub04210  Apoptosis
bbub04215  Apoptosis - multiple species
bbub04217  Necroptosis
bbub04650  Natural killer cell mediated cytotoxicity
bbub04932  Non-alcoholic fatty liver disease
bbub05010  Alzheimer disease
bbub05014  Amyotrophic lateral sclerosis
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05168  Herpes simplex virus 1 infection
bbub05169  Epstein-Barr virus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102399521 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102399521 (BID)
   04215 Apoptosis - multiple species
    102399521 (BID)
   04217 Necroptosis
    102399521 (BID)
   04115 p53 signaling pathway
    102399521 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102399521 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102399521 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102399521 (BID)
   05014 Amyotrophic lateral sclerosis
    102399521 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    102399521 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102399521 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102399521 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102399521 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102399521 (BID)
   05161 Hepatitis B
    102399521 (BID)
   05160 Hepatitis C
    102399521 (BID)
   05164 Influenza A
    102399521 (BID)
   05162 Measles
    102399521 (BID)
   05168 Herpes simplex virus 1 infection
    102399521 (BID)
   05163 Human cytomegalovirus infection
    102399521 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102399521 (BID)
   05169 Epstein-Barr virus infection
    102399521 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102399521 (BID)
SSDB
Motif
Pfam: BID Bcl-2
Other DBs
NCBI-GeneID: 102399521
NCBI-ProteinID: XP_006071478
LinkDB
Position
4
AA seq 193 aa
MDLKVSNGPGPGDERTTSLLLLGFLQSCPHSCFQRELEALGHELPGRLFHDDELQTDGNR
CSHFPLAAEAETDSERQEEAVREVARQLAQIGDRLEGSIHPGMVAGLASRFSVRSLSEED
RRQCLAAVLEQLMQTCPPDMDHEKTQLLLTMLLAKKIADHSPALLRDVFRTTVTFINQNL
LAYVRNLVRNQMD
NT seq 582 nt   +upstreamnt  +downstreamnt
atggatttgaaggttagcaacggccccggccccggggacgagcgcaccacgagcctgctg
ctgctgggcttcctgcagagctgcccccactcctgcttccagagggagctggaggcgctg
ggtcacgagttgcctgggcgcctgttccatgacgatgagctgcagacggacggcaaccgc
tgcagccacttccccttggcagcggaagcggagacagattctgagcgtcaggaggaggca
gtccgcgaagtcgcccggcagctcgcccagattggggacaggctggagggcagcatccac
ccagggatggtggccggcctggcctcacgcttcagtgtcaggagcctgtcggaggaggac
aggaggcagtgcctggcggctgtgctagaacagctcatgcaaacctgccctccggacatg
gaccacgagaagacccagctcctgctcaccatgctcttggccaaaaagatagccgaccac
tcgccagccttgctccgagatgtcttccgcacaacggtgaccttcatcaaccagaacctc
ctcgcctatgtgaggaacttagtccgaaatcagatggactga

DBGET integrated database retrieval system