KEGG   Bubalus bubalis (water buffalo): 102399561
Entry
102399561         CDS       T05912                                 

Definition
(RefSeq) cytochrome P450 1A2
  KO
K07409  cytochrome P450 family 1 subfamily A2 [EC:1.14.14.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00140  Steroid hormone biosynthesis
bbub00232  Caffeine metabolism
bbub00380  Tryptophan metabolism
bbub00591  Linoleic acid metabolism
bbub00830  Retinol metabolism
bbub00980  Metabolism of xenobiotics by cytochrome P450
bbub00982  Drug metabolism - cytochrome P450
bbub01100  Metabolic pathways
bbub05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102399561
   00591 Linoleic acid metabolism
    102399561
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    102399561
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102399561
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102399561
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102399561
   00982 Drug metabolism - cytochrome P450
    102399561
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102399561
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bbub00199]
    102399561
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     102399561
Cytochrome P450 [BR:bbub00199]
 Cytochrome P450, animal type
  CYP1 family
   102399561
SSDB
Motif
Pfam: p450 Sec8_exocyst
Other DBs
NCBI-GeneID: 102399561
NCBI-ProteinID: XP_006080708
LinkDB
Position
20
AA seq 516 aa
MALSQPSPFSAMELLLASAVFCLVFWVVRTWRPRVPQGLKSPPEPWSWPLLGHMLTLGKN
PHVVLSQLSQRYGDVLQIRLGCTPVLVLSGLDTIRQALVRQGDDFKGRPDLYSFTLVTDG
QSLTFNPDSGPVWAARRRLAQNALNTFSVASDPSSSSSCYLEDHVSKEAEALLGKFQELM
SGPGHFDPYGHVVASVANVIGAVCFGQHFPQSSKEMLSLVESSHDFVESASSGNPVDFFP
ILKYLPNPALQRFKSFNQRFLQFLRKTVQEHYQDFDKNSIQDIIGALFKHSEDNSRASSR
LISQEKTVNLVNDLFAAGFDTITTAISWSLMYLVTNPKIQRKIQEELDRVIGRARRPRLS
DRPQLPYLESFILETFRHSSFVPFTIPHSTTRDTTLNGFFIPKERCVFINQWQVNHDPKL
WGDPSEFRPERFLTSDGTAIDKMASEKVLLFGMGKRRCIGEVMARWEVFLFLAILLQRLE
FSVPPGVKVDLTPTYGLTMKHASCEHVQARLRFPIK
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggcattgtcccaacccagtcccttctcagccatggagcttctcctggcctctgccgtc
ttctgcctggtattctgggtggtcaggacctggcggcctcgggtccctcaaggcctgaag
agtccaccggagccctggagctggcccctgcttgggcacatgctgacgttggggaagaac
ccacacgtggttctgtcgcagctgagccagcgctatggggacgtgctgcagatccgcctt
ggctgcacacccgtgctggtgctcagcggcctggacaccatccggcaggccctggtgcgg
cagggcgatgatttcaagggccggcccgacctctacagcttcaccttggtcactgatggc
cagagcctgaccttcaacccagactctggaccagtgtgggctgcccggcgacgcctggcc
cagaatgctctcaacaccttctctgtggcctcagacccatcttcctcctcctcctgctac
ctggaggatcatgtgagcaaggaggctgaggccctcctgggcaagttccaggagctgatg
tcagggcctgggcacttcgacccctatggccacgtggtggcatcagtggccaacgtcatc
ggtgccgtgtgcttcgggcagcacttcccccagagcagtaaggagatgctcagtctggtg
gagagcagccatgattttgtggaatccgccagctccgggaatcccgtggacttcttcccc
atccttaaatacctgcccaacccggctctgcaaaggttcaagagcttcaaccagaggttc
ctgcagttcttgcggaaaacggtccaggagcactaccaggactttgacaagaacagcatc
caggacatcataggcgccctgttcaagcacagtgaggataactcccgagccagcagtcgc
ctcatctcccaggagaagactgtcaaccttgtcaacgacctctttgcggctgggttcgac
accatcacaacagccatctcctggagccttatgtaccttgtgacaaatcctaagatacag
agaaagatccaggaggagctggacagagtgattggcagggcacggcggccccggctctcc
gacagaccccagctgccctatttggagtccttcatcctggagaccttccgacactcctcc
tttgtccccttcaccatccctcatagcacaacaagggatacaacactgaatggcttcttc
atacccaaggaacgctgtgtcttcataaaccagtggcaggtcaatcatgacccgaagctg
tggggggacccatctgagttccggccagagagattcctcacatctgatggcaccgccatt
gataagatggcaagcgagaaagtgttactcttcggcatgggcaagcgccgatgcataggg
gaggtcatggccaggtgggaggtcttcctcttcctggccatcttgctgcagcggctggag
ttcagcgtgccaccaggtgtgaaagtggacctaacccccacctatgggctgaccatgaag
catgcctcctgtgagcatgtgcaggctcggctgcgcttccccatcaagtga

DBGET integrated database retrieval system