KEGG   Bubalus bubalis (water buffalo): 102399807
Entry
102399807         CDS       T05912                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04630  JAK-STAT signaling pathway
bbub04640  Hematopoietic cell lineage
bbub05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102399807 (IL3RA)
   04151 PI3K-Akt signaling pathway
    102399807 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102399807 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102399807 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102399807 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102399807 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bbub04050]
    102399807 (IL3RA)
   04090 CD molecules [BR:bbub04090]
    102399807 (IL3RA)
Cytokine receptors [BR:bbub04050]
 Interleukin receptor families
  IL3 receptor family
   102399807 (IL3RA)
CD molecules [BR:bbub04090]
 Proteins
  102399807 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind PsbJ
Other DBs
NCBI-GeneID: 102399807
NCBI-ProteinID: XP_025132536
LinkDB
Position
X
AA seq 419 aa
MALPWLAVLLTLICCSMTTDHAISDPDPPIKNLRIDPERKRLVWDQHGNVSEIECYVNSK
ILRKVIEKPYCSLGDLSCEVKNYTVQVIKGPPFSTWIQYPKQGNPLAAADNLTCRVHDVD
QLSCSWAVGEEAPANVQYHFYLKHPQQTWPCPKYMQNQQGVNVQCHFDSLSLQPQHQTEF
RFLVNGTSGGSQIPCRQMIHRLEEIEILAAPNITKKWCNESYSFMEWEVRSLFTEDIKYE
LEIQKGMDLAYKQETELKVLGLRNPGPYTVKIKAMDSLFFGSRPAGQWSAPQHLDCGRKD
ASFPFWLVCLLAPLGALLLVGLVFLCRRSQGAQSPQCSIRGARGCPASPGPQCAWGALSA
ARLCGWAPHAPCTVLLTPRRDALGPTPPPPATSALASGRPPEPSRQAAGGRGGVLPFQP
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggccctcccatggctggccgtgctcctgacactcatctgctgctcgatgaccacggac
cacgccatctctgatccagacccaccgattaagaacttaaggatagatccagaaagaaaa
agattggtctgggaccagcacggaaatgtttctgaaattgagtgttacgtcaattcgaaa
attttaagaaaggtaatagagaagccctattgcagtcttggcgacttgtcatgcgaagtg
aaaaactacactgtgcaggtgataaaaggcccaccgttctctacttggattcagtatcca
aagcaaggcaaccccctggcggccgcggacaacctgacctgccgggtgcacgacgtggat
cagctcagctgcagctgggcggtgggcgaggaggccccggcgaacgtgcaataccatttc
tatctgaagcacccccagcagacgtggccatgtcccaagtacatgcagaaccagcagggc
gtcaacgtccagtgccattttgacagcctctcccttcaacctcaacaccaaactgagttc
cgtttcctggtgaatggtaccagcggtggttcccaaatcccctgccgccaaatgatccat
agattggaagaaattgaaatattagctgccccgaacatcacaaaaaagtggtgtaatgaa
agctactcgttcatggaatgggaagtaaggagtctctttactgaagacatcaagtatgaa
cttgagatacagaagggcatggacctcgcctacaaacaggagacagagctcaaggttttg
gggctgaggaatccgggaccctacacagtgaagatcaaggccatggactccctgttcttc
gggagcagaccggcaggccagtggagcgccccgcagcacctcgactgtggccgcaaggac
gcgtccttcccgttctggctggtgtgcctcctggccccgctcggggcgctgctcctggtg
gggctcgtgttcctgtgtcgcagaagccaaggcgcccaaagtccacagtgcagcatccgg
ggagcgcgggggtgtcctgcctccccgggcccccagtgcgcgtggggcgcgctgtctgcg
gccaggctctgcggctgggccccacacgccccctgcactgtgctcctcacacctcgccgc
gacgctctgggccccaccccgccgccaccagcaacctccgcactggcctcagggaggcct
cccgagcccagcagacaggcagcaggcggacgtggtggagtgctgccctttcagccctga

DBGET integrated database retrieval system