KEGG   Bubalus bubalis (water buffalo): 102400134
Entry
102400134         CDS       T05912                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein isoform X1
  KO
K06618  retinoblastoma-associated protein
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04110  Cell cycle
bbub04218  Cellular senescence
bbub04934  Cushing syndrome
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05212  Pancreatic cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102400134 (RB1)
   04218 Cellular senescence
    102400134 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102400134 (RB1)
   05203 Viral carcinogenesis
    102400134 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102400134 (RB1)
   05225 Hepatocellular carcinoma
    102400134 (RB1)
   05226 Gastric cancer
    102400134 (RB1)
   05214 Glioma
    102400134 (RB1)
   05220 Chronic myeloid leukemia
    102400134 (RB1)
   05218 Melanoma
    102400134 (RB1)
   05219 Bladder cancer
    102400134 (RB1)
   05215 Prostate cancer
    102400134 (RB1)
   05224 Breast cancer
    102400134 (RB1)
   05222 Small cell lung cancer
    102400134 (RB1)
   05223 Non-small cell lung cancer
    102400134 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102400134 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102400134 (RB1)
   05161 Hepatitis B
    102400134 (RB1)
   05160 Hepatitis C
    102400134 (RB1)
   05163 Human cytomegalovirus infection
    102400134 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102400134 (RB1)
   05169 Epstein-Barr virus infection
    102400134 (RB1)
   05165 Human papillomavirus infection
    102400134 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102400134 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bbub01009]
    102400134 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102400134 (RB1)
Protein phosphatases and associated proteins [BR:bbub01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102400134 (RB1)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    102400134 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1 TFIIB
Other DBs
NCBI-GeneID: 102400134
NCBI-ProteinID: XP_025119029
LinkDB
Position
13
AA seq 929 aa
MPPKTPRRAAAAAAAAAAAEPPPPPLPPPPEEDPEQDSGSEDLPLARLEFEETEEPDFTA
LCQKLKLPDHVRERAWLTWEKVSSVDGVLEGYVQKKKELWGICIFIAAVDLDEMPFTFTE
LQKNIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSS
SISTEINSMLVLKVSWITFLLAKGQVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKEPY
KTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPF
MNSLGIVASNGLPEVENLSKQYEEIYLKNKDLDARLFLDHDKTLQADPTDSFEMQRTPRK
SNPDEEVNMILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRV
KDIGDVFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLND
NIFHMSLLACALEVVMATYSRSMSQSLDTGTDLSFPWILNVFNLKAFDFYKVIESFIKAE
ANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPVDHFEPACTLNLPLQNN
HTAADMYLSPVRSPKKKGSSPRVNSTPNSEAQATSAFQTQKPLKSTSLSLFYKKVYRLAY
LRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDL
KFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTL
SPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGLPTPTKMTPRSRILVSIGESF
GTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQ
KLAEMTSTRTRMQKQKMNESMDTSNREEK
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagccgccgccgccgccgccgccgccgccgcggag
cccccgccgccgcccctgccgccgccccctgaggaggaccccgagcaggacagcggctcc
gaggacctgcctctggccaggcttgagtttgaagaaactgaagaacctgattttactgca
ttatgtcagaaattaaagctaccagatcatgtcagagaaagagcttggttaacttgggaa
aaagtttcatctgtggatggagtattggaaggttatgttcaaaagaaaaaggaactgtgg
ggaatctgtatctttatcgcagcagttgacttagatgagatgccgttcactttcactgaa
ctacagaaaaacattgaaacaagtgtctataaattctttgatttactaaaagaaatcgat
actagtaccaaagttgataatgctatgtcaagactgttgaagaagtataatgtgttgtgt
gcgctctacagcaaattagaaaggacatgtgagcttatatatttgacacaacccagcagt
tcgatatctactgaaataaattctatgttggtgctaaaagtttcttggatcacattttta
ttagctaaaggacaagtattacaaatggaagatgatctggtgatctcatttcaattaatg
ctgtgtgtccttgactattttatcaaactctcacctcctgcattgctcaaagaaccatat
aaaacagctgtaatacctattaatggttcacctcgaacaccaaggcgaggtcagaacagg
agtgcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaa
gaacatgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttatacctttt
atgaattctcttggaattgtagcttctaatggacttccagaggtggaaaatctctctaaa
caatatgaagaaatttaccttaaaaacaaagatctagatgcaagattatttctggatcat
gacaaaactcttcaggctgatcctacagacagttttgaaatgcaaagaacaccacgaaaa
agtaaccctgatgaagaggtgaatatgattcttccacagactccagttagaactgttatg
aatactatccaacaattaatgatgatcttaaattcagcaagtgatcaaccatcggaaaat
ctgatttcctattttaataattgcacagtgaatccaaaggaaagtatcctgaaaagagtg
aaggatattggggacgtctttaaagagaaatttgctaaagctgtgggacaaggatgtatg
gaaattggatcacagcgatacaaacttggagtccgattgtattaccgagtaatggaatcc
atgcttaaatcagaagaagaacgattatccattcaaaattttagcaaactcctgaatgac
aacatctttcatatgtctttgttggcatgcgctcttgaggttgtaatggctacctatagc
agaagtatgtctcagagcctggatactggaacagatctatccttcccatggattctgaat
gtatttaacttaaaagcttttgatttttacaaagtgattgaaagtttcatcaaagcggaa
gccaacctgaccagagaaatgattaaacatttagaacgatgtgaacatcgaatcatggag
tcccttgcatggctctcagattcacctttatttgatcttattaaacaagcgaaggaccga
gaaggaccagttgatcactttgaacctgcctgtactctcaaccttcctctccagaataat
cacactgcagcagatatgtatctttctcctgtaagatccccaaagaaaaaagggtcaagt
ccacgtgtaaattctactccaaattcagaggcacaagcaacctcagccttccagactcag
aagccattgaaatctacctccctttcactcttctacaaaaaagtgtatcgactagcatat
cttcgactgaacaccctgtgtgcacgccttctgtctgaccacccagaactagagcatatc
atctggacccttttccagcacacactgcaaaatgagtatgaactcatgagagacaggcat
ttggaccagattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagacctt
aaattcaaaatcattgtcacagcatacaaagatcttcctcatgctgttcaggagacattc
aaacgtgttttgatcagagaagaggagtatgattccattatcgtattctataattcggtc
ttcatgcagagactgaaaacaaatattttgcagtacgcttccaccaggccccctaccttg
tcaccgattcctcacattcctcgaagcccttacaagttttctagttcacctttacggatt
cctggggggaacatctatatatcacccctaaagaatccatataaaatttcagaaggtctg
ccgacaccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcattt
gggacttccgagaagttccagaaaataaatcaaatggtgtgtaacagtgaccgtgtgctc
aaaagaagtgctgaaggaagcaaccctcctaaaccactgaaaaaactgcgttttgacatc
gaaggatccgatgaagcagatggaagtaaacatctcccaggggaatccaaatttcaacag
aaactggcagaaatgacatctactcgaacacgaatgcaaaagcagaaaatgaatgagagc
atggatacctcaaacagggaagaaaagtga

DBGET integrated database retrieval system