KEGG   Bubalus bubalis (water buffalo): 102401026
Entry
102401026         CDS       T05912                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00220  Arginine biosynthesis
bbub00330  Arginine and proline metabolism
bbub01100  Metabolic pathways
bbub04020  Calcium signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04146  Peroxisome
bbub04371  Apelin signaling pathway
bbub04926  Relaxin signaling pathway
bbub05010  Alzheimer disease
bbub05014  Amyotrophic lateral sclerosis
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05133  Pertussis
bbub05140  Leishmaniasis
bbub05142  Chagas disease
bbub05145  Toxoplasmosis
bbub05146  Amoebiasis
bbub05152  Tuberculosis
bbub05200  Pathways in cancer
bbub05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102401026 (NOS2)
   00330 Arginine and proline metabolism
    102401026 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102401026 (NOS2)
   04066 HIF-1 signaling pathway
    102401026 (NOS2)
   04020 Calcium signaling pathway
    102401026 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102401026 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102401026 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401026 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102401026 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102401026 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102401026 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    102401026 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102401026 (NOS2)
   05152 Tuberculosis
    102401026 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102401026 (NOS2)
   05145 Toxoplasmosis
    102401026 (NOS2)
   05140 Leishmaniasis
    102401026 (NOS2)
   05142 Chagas disease
    102401026 (NOS2)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102401026 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102401026
NCBI-ProteinID: XP_006046883
LinkDB
Position
3
AA seq 1156 aa
MACPWQFLFKIKSQKVDLATELDINNNVGKGHQPPASPVTQDDPKRHSPGKHGNESPQPL
TGTVKTSPESLSKLDAPPSACPRHVRIKNWGSGVTFQDTLHQKAKGDLSCKSKSCLASIM
NPKSLTIGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPASVEFTQLCIDLGWKPKYG
RFDVLPLVLQADGRDPELFEIPPDLVLEVPMEHPRYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEVGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVVEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDERRRPQRREIRFKVLVKAVFFASVLMHKAMASRVRAT
ILFATETGRSETLAQDLGALFSCAFNPKVLCMDQYRLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLLMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFDVSGKHHIEIPKLYTSNVTWDPQHYRLVQDSEPLDL
NKALSSMHAKHVFTMRLKSQQNLQSPKSSRTTLLVELSCEGSQAPNYLPGEHLGVFPCNQ
PALVQGILERVVDGPALHQTVRLETLCENGSYWVKDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAEKQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQL
PILKPRYYSISSSRDLTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASGFQLPEDRSRPCILIGPGTGIAPFRSFWQQRLHEAEHKGLQGGRMTLVFGCRRPE
EDHLYWEEMLEMARKGVLHEVHTAYSRLPDQPKVYVQDILRQRLAGEVLRVLHEEQGHLY
VCGDVRMARDVACTLKQLMATALSLNEEQVEDYFFQLKNQKRYHEDIFGAVFPYEVKKDG
AAGLPSDPRAPGAHRS
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaaatcaaatcccaaaaggtggacttggctacg
gaactggacatcaacaacaacgtgggaaaaggccaccagcccccggccagtccagtgaca
caggatgaccccaaacgtcacagcccgggcaagcacgggaatgagtctccccagccccta
acggggacagtaaagacatctccagaatccctgagcaagctggacgcacccccgtcagcc
tgtccacggcatgtgaggatcaaaaactggggcagcggagtgactttccaagacacgctt
caccagaaggccaaaggggatctctcttgcaagtccaagtcttgcctggcatccatcatg
aaccccaaaagtttgaccataggaccccgggacaagccaacccccccagacgagcttcta
cctcaagctatcgaatttgtcaaccagtattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatctttgccaccaagcaggcctggcgcaatgccccccgctgc
atcgggaggatccagtggtcgaacctgcaggtctttgatgcccggagctgttccacggcc
caggaaatgttcgaacacatctgcagacacgtgcgttattccaccaacaacggcaacatc
aggtcggccatcactgtgttcccccagcggagcgatgggaagcatgacttccgggtctgg
aacgcccagctcatccgctatgccggctaccagatgccagatggcagcatcagaggggac
cccgccagcgtggagttcacacagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgacgtgttgcctctagtcctgcaggctgacggccgtgacccagagctcttcgaa
attccccctgaccttgtactcgaggtgcccatggaacatcccaggtacgagtggttccgg
gagctggagctcaagtggtatgccctgccagccgtggccaacatgctgcttgaggtgggc
ggcctcgagttcccagggtgccccttcaacgggtggtacatgggcacagaagttggagtc
cgggacttctgcgacgtccagcgatacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacgcacaagctggcctcactctggaaggaccgggctgtcgttgagatcaacgtc
gctgtgctccacagtttccagaagcagaacgtgaccatcatggaccaccactctgctgca
gagtccttcatgaagtacatgcagaatgagtaccgctcccgagggggctgcccagctgac
tggatttggctggtccccccgatctctggaagcatcaccccggtgttccaccaggagatg
ttaaattacgtcctctcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaggacgagaggcggagaccccagagaagagagattcgatttaaagtcttggtcaaa
gctgtgttcttcgcctcggtgctgatgcataaggccatggcatcccgggtcagagccacg
atcctctttgcaacagagacggggaggtcggaaacgctggcccaggacctcggggctttg
ttcagctgtgccttcaaccccaaggttctctgcatggatcagtaccggctgagccatctg
gaggaggaacagctgctgctggtggtgaccagcacttttggcaacggagactcccctggc
aacggagagaaactgaagaagtccctcttgatgctgaaagaactcaccaacaagttccgg
tacgccgtgtttggccttggctccagcatgtaccctcagttctgcgcttttgctcatgac
atcgaccagaagttgtcccagctgggggcttctcagcttgccccaaccggggaaggggac
gagctcagcgggcaggaggaggccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacattcgatgtcagtggcaagcaccacattgagatccccaagctctacacttcc
aatgtgacctgggacccgcaacactacaggctcgtgcaggactcagagcctctggacctc
aacaaagccctgagcagtatgcacgccaagcatgtgttcaccatgaggctcaaatcacag
cagaatctgcagagtccgaaatccagccgcaccaccctcttggtggaactctcctgtgag
ggcagccaagctccaaactacctgccgggagagcacctcggagttttcccatgcaaccag
ccagccctggttcaaggcatccttgagcgagtggtggatggccctgccctgcaccagact
gtgcgcctggagaccctctgtgagaatggcagctactgggtcaaggacaagcggctgcca
ccttgctcactcagccaggctctcacctatttcctggacatcaccaccccgccaacccag
ctgctgctccgaaagctggcccagctggctacagaagaggctgagaagcagaggctggag
accctatgccagccctcagattacaacaagtggaagttcaccaacagccccacattcctg
gaggtgctggaggagttcccgtccctgcgggtgtctgccagcttcctgctctcccagctc
cctattctgaagccccggtactactccatcagctcctccagggacctcacacccacggag
atccacctcactgtggccgtgctcacgtaccgcacccgagatggccaaggtcccctgcac
catggcgtctgcagcacgtggctcagcagcttgaagccccaagacccggtgccctgcttt
gtgcgaagtgccagcggcttccagcttcccgaggaccgctcccgtccttgcatcctcatc
ggacccggcacaggcatcgcccccttccgcagtttctggcagcagcggctccatgaggct
gagcacaaagggctccagggcggccgcatgaccctggttttcgggtgccgccgcccggaa
gaggaccacctctactgggaggagatgctggagatggcccgcaagggggtgctgcacgag
gtgcacaccgcctattcccgcctgcctgaccagcccaaggtctatgttcaagacatcctg
cggcagcggctagcgggcgaggtgcttcgcgtgctccatgaggagcaaggccacctctat
gtctgtggggacgtgcgcatggcccgggacgtggcctgcaccctgaagcagctgatggct
actgcgctgagcctgaacgaggagcaggtggaggactatttcttccagctcaagaaccag
aagcgctatcatgaagacatctttggtgctgtatttccctatgaggtgaaaaaggatggg
gcagcagggctgcccagtgatcccagagctccaggcgcccacagaagttaa

DBGET integrated database retrieval system