KEGG   Bubalus bubalis (water buffalo): 102401079
Entry
102401079         CDS       T05912                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X4
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04015  Rap1 signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04068  FoxO signaling pathway
bbub04150  mTOR signaling pathway
bbub04270  Vascular smooth muscle contraction
bbub04510  Focal adhesion
bbub04650  Natural killer cell mediated cytotoxicity
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04934  Cushing syndrome
bbub05010  Alzheimer disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102401079 (BRAF)
   04012 ErbB signaling pathway
    102401079 (BRAF)
   04015 Rap1 signaling pathway
    102401079 (BRAF)
   04068 FoxO signaling pathway
    102401079 (BRAF)
   04024 cAMP signaling pathway
    102401079 (BRAF)
   04150 mTOR signaling pathway
    102401079 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102401079 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102401079 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102401079 (BRAF)
   04062 Chemokine signaling pathway
    102401079 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102401079 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102401079 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102401079 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102401079 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102401079 (BRAF)
   04720 Long-term potentiation
    102401079 (BRAF)
   04730 Long-term depression
    102401079 (BRAF)
   04722 Neurotrophin signaling pathway
    102401079 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401079 (BRAF)
   05205 Proteoglycans in cancer
    102401079 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102401079 (BRAF)
   05212 Pancreatic cancer
    102401079 (BRAF)
   05225 Hepatocellular carcinoma
    102401079 (BRAF)
   05226 Gastric cancer
    102401079 (BRAF)
   05214 Glioma
    102401079 (BRAF)
   05216 Thyroid cancer
    102401079 (BRAF)
   05221 Acute myeloid leukemia
    102401079 (BRAF)
   05220 Chronic myeloid leukemia
    102401079 (BRAF)
   05218 Melanoma
    102401079 (BRAF)
   05211 Renal cell carcinoma
    102401079 (BRAF)
   05219 Bladder cancer
    102401079 (BRAF)
   05215 Prostate cancer
    102401079 (BRAF)
   05213 Endometrial cancer
    102401079 (BRAF)
   05224 Breast cancer
    102401079 (BRAF)
   05223 Non-small cell lung cancer
    102401079 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102401079 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    102401079 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    102401079 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102401079 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102401079 (BRAF)
   05160 Hepatitis C
    102401079 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102401079 (BRAF)
   01522 Endocrine resistance
    102401079 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102401079 (BRAF)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102401079 (BRAF)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102401079 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 102401079
NCBI-ProteinID: XP_006078854
LinkDB
Position
8
AA seq 765 aa
MAALSGGGGGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTS
SSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASLAETTLPCGSSPSAPPSDSIGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLSNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggtggcggcggcggcggcggcgcggagcagggccaggctctg
ttcaatggggacatggagcccgaggccggcgccgcggcctcttcggctgcggaccccgcc
attcccgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagag
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaagctagatgccctccaacaaagagaacaacagttattggaatcc
ctggggaatggaactgatttttctgtttctagctctgcatcaacggacaccgttacatct
tcttcctcttctagcctttcagtgctgccttcatctctttcagtttttcaaaatcccaca
gatgtgtcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aataaacagaggacagtggtacctgcacggtgtggagtcacagtccgggacagcctgaag
aaggcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggggagaagaaaccaattggctgggacactgatatttcctggcttactggagaggagttg
catgtagaagtgttggagaatgttccacttacaacacacaactttgtacggaaaactttt
ttcaccttagcattttgtgacttctgtagaaagctgcttttccaggggttccgctgtcaa
acatgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaactagatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaggaggcctccttagcagagactacccttccatgtggctcatctccttctgcacccccc
tccgattctattgggcccccaattctcaccagtccatctccttcaaaatccattccaatt
ccacagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccgg
tcctcatcagctccaaatgtgcatataaacacaatagaacccgtcaatattgatgacttg
attagagaccaagggtttcgtagtgatggaggatcaaccacaggtttatccgccacaccc
cctgcctcattacctggctcactctctaatgtgaaagcattgcagaaatctccaggacct
cagcgagaaagaaagtcctcttcatcctcagaagataggaatcgaatgaaaacgcttggt
agacgggattcaagtgacgattgggagattcctgatggacagatcacagtgggacaaaga
attggatcagggtcatttgggacggtctacaagggaaagtggcatggtgatgtggcagtg
aaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagta
ggagtactcaggaaaacgcgacatgtgaatatcctcctcttcatgggttattcaacaaag
ccacaactggctattgttacccagtggtgtgagggctccagtttatatcatcatctccac
atcattgagaccaaattcgagatgatcaaacttatagatattgcacggcagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatt
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtaatcagaatgcaagataaaaacccatatagctttcagtcagatgtatatgcattt
gggattgttctgtatgaattgatgaccggacagttaccttattcaaatatcaacaacagg
gaccagataatttttatggtgggacgaggatatctgtctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctaaaaaagaaaagagat
gaaagaccactctttccccaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaacagaggat
tttagtctatatgcttgtgcttctccaaaaacacccattcaggcagggggatatggagaa
tttgcagccttcaagtag

DBGET integrated database retrieval system