KEGG   Bubalus bubalis (water buffalo): 102401080
Entry
102401080         CDS       T05912                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub04012  ErbB signaling pathway
bbub04062  Chemokine signaling pathway
bbub04110  Cell cycle
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04310  Wnt signaling pathway
bbub04340  Hedgehog signaling pathway
bbub04360  Axon guidance
bbub04390  Hippo signaling pathway
bbub04510  Focal adhesion
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04657  IL-17 signaling pathway
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04722  Neurotrophin signaling pathway
bbub04728  Dopaminergic synapse
bbub04910  Insulin signaling pathway
bbub04916  Melanogenesis
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub04934  Cushing syndrome
bbub04935  Growth hormone synthesis, secretion and action
bbub05010  Alzheimer disease
bbub05020  Prion disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05135  Yersinia infection
bbub05160  Hepatitis C
bbub05162  Measles
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05200  Pathways in cancer
bbub05210  Colorectal cancer
bbub05213  Endometrial cancer
bbub05215  Prostate cancer
bbub05217  Basal cell carcinoma
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102401080 (GSK3B)
   04310 Wnt signaling pathway
    102401080 (GSK3B)
   04340 Hedgehog signaling pathway
    102401080 (GSK3B)
   04390 Hippo signaling pathway
    102401080 (GSK3B)
   04151 PI3K-Akt signaling pathway
    102401080 (GSK3B)
   04150 mTOR signaling pathway
    102401080 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102401080 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102401080 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    102401080 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102401080 (GSK3B)
   04657 IL-17 signaling pathway
    102401080 (GSK3B)
   04662 B cell receptor signaling pathway
    102401080 (GSK3B)
   04062 Chemokine signaling pathway
    102401080 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102401080 (GSK3B)
   04917 Prolactin signaling pathway
    102401080 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    102401080 (GSK3B)
   04919 Thyroid hormone signaling pathway
    102401080 (GSK3B)
   04916 Melanogenesis
    102401080 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102401080 (GSK3B)
   04722 Neurotrophin signaling pathway
    102401080 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    102401080 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401080 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102401080 (GSK3B)
   05225 Hepatocellular carcinoma
    102401080 (GSK3B)
   05226 Gastric cancer
    102401080 (GSK3B)
   05217 Basal cell carcinoma
    102401080 (GSK3B)
   05215 Prostate cancer
    102401080 (GSK3B)
   05213 Endometrial cancer
    102401080 (GSK3B)
   05224 Breast cancer
    102401080 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102401080 (GSK3B)
   05020 Prion disease
    102401080 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    102401080 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102401080 (GSK3B)
   04931 Insulin resistance
    102401080 (GSK3B)
   04934 Cushing syndrome
    102401080 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102401080 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102401080 (GSK3B)
   05162 Measles
    102401080 (GSK3B)
   05163 Human cytomegalovirus infection
    102401080 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102401080 (GSK3B)
   05165 Human papillomavirus infection
    102401080 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102401080 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102401080 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102401080 (GSK3B)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     102401080 (GSK3B)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   102401080 (GSK3B)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102401080 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 102401080
NCBI-ProteinID: XP_006057658
LinkDB
Position
1
AA seq 432 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPSNTTAASDANAGDRGQ
TNNAASASASDS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcggcttttggcagcatgaaagttagcagagacaaagatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtgtatcaagccaaactttgtgattcaggagaa
ttggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gaaaagaaagatgaggtctatcttaatctggtgctggactacgttccggaaacagtctac
agagtcgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatagg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttgaaactctgtgac
tttggaagtgcaaagcagctggtccgtggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttgctaggacagccaatatttccaggagac
agtggtgtggatcagttggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attcgagaaatgaacccaaactacacggaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cgaactccacccgaggcgatcgcactttgtagccgtctgctggagtatacaccaactgcc
cgactgacaccactggaagcttgcgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaactccttcaaataccacagcagcctcagatgctaatgctggagaccgtggacag
accaataatgctgcttctgcatcagcttccgactcctga

DBGET integrated database retrieval system