KEGG   Bubalus bubalis (water buffalo): 102401159Help
Entry
102401159         CDS       T05912                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01040  Biosynthesis of unsaturated fatty acids
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102401159 (SCD5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102401159 (SCD5)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102401159 (SCD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102401159 (SCD5)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102401159 (SCD5)
Lipid biosynthesis proteins [BR:bbub01004]
 Desaturase
  First
   102401159 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102401159
NCBI-ProteinID: XP_025145597
LinkDB All DBs
Position
7
AA seq 335 aa AA seqDB search
MPGPAVDAEKVPFRSAKEEIRAGVGVEGSEGGGGGGGRERPGARGHRQDIVWRNVFLMSL
LHLAAVYSLVLIPKAQPLTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAA
NSMAFQNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLD
VTDLLADPVVRFQRKYYKITVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNVT
WLVNSVAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTT
WFIDFMCWLGLATDRKRATKQMIEARKARTGDGSA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccgtggacgcggagaaggtccccttccgcagcgccaaggaggagatc
cgtgcgggggtaggggtcgagggctcggagggcggcggcggcggcggcggccgggagagg
cccggcgcgcgcgggcaccggcaggacatcgtctggaggaacgtgttcctgatgagcctg
ctccacttggcggccgtgtactccctggtgctcatccccaaagcccagccgctcactctg
ctctgggcctacttctgcttcctcctgactgctctgggcgtgacagctggtgcccatcgt
ttgtggagccacaggtcctacaaggctaagctacccctgaggatatttctggctgctgcc
aactccatggctttccagaacgacatcttcgagtggtcgagggaccaccgagtccatcac
aagtactcggagacggacgctgacccgcacaatgcccgccggggcttcttcttctcccac
atcggctggctgtttgtccgcaagcatcgggacgtcattgagaaggggaggaagcttgac
gtcaccgacttgctggctgaccccgtggtccggttccagagaaagtactacaagatcacc
gtggtgctcatgtgcttcgtagtccccacgctggtgccctggtacatctggggagagagc
ctgtggaactcctacttcctggcctccatcctccgctacaccatctcactcaacgtcacc
tggctggtcaacagcgtcgcccacatgtacggaaaccggccctatgacaagcacatcagt
cctcggcagaacccactcgtcaccctgggtgccattggtgaaggtttccataactaccat
cacacctttccctttgactactctgcgagtgaatttggcttaaatttcaacccaaccacc
tggttcattgacttcatgtgttggctggggctagccactgaccgcaaacgggcaaccaag
cagatgatcgaagcccggaaagcccggactggagacggaagcgcctga

KEGG   Bubalus bubalis (water buffalo): 102401664Help
Entry
102401664         CDS       T05912                                 

Gene name
SCD
Definition
(RefSeq) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01040  Biosynthesis of unsaturated fatty acids
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102401664 (SCD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102401664 (SCD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102401664 (SCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102401664 (SCD)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102401664 (SCD)
Lipid biosynthesis proteins [BR:bbub01004]
 Desaturase
  First
   102401664 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102401664
NCBI-ProteinID: NP_001277844
UniProt: A4IEA5
LinkDB All DBs
Position
23
AA seq 359 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPETRDDIYDPTYQ
DKEGPKPKLEYVWRNIILMFLLHLGALYGITLIPTCKIYTYLWVLFYYLMGALGITAGAH
RLWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVIEKGSTLNLSDLKAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWGE
TFQNSLFFATLFRYALGLNITWLVNSAAHMYGYRPYDKTISPRENILVSLGAVGEGFHNY
HHTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARMKRTGEESYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaagaggagatctctagctcctacacaaccaccaccaccatc
acagcacctccttccagggtcctgcagaatggagggggcaaattggaaaagactccccta
tacttggaagaagacatccgccctgaaacgagagatgacatctatgacccaacttaccag
gataaggagggcccaaagcccaagcttgagtatgtttggagaaacatcatcctcatgttt
ctgttacacttgggagccctatatgggatcacattgatccccacctgcaagatatacacc
tatctctgggtgttattctactatctgatgggtgccctgggcatcacagcaggggcccat
cgcctgtggagtcaccgaacctacaaagctcggctgcccctgcgggtcttcctgatcatc
ggcaacaccatggcgttccagaatgacgtttttgaatggtcccgagatcaccgtgcccac
cacaagttttcagaaacggatgctgatccccacaattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcatagaaaagggttctacgcta
aatttatccgacctaaaagccgagaagctggtaatgttccagaggaggtactacaaacct
ggtgtcctgttgttgtgcttcatcctgcccacactcgtgccgtggtatctgtggggtgaa
acgtttcaaaacagcctgttttttgccaccttattccgttatgcccttgggctcaacatc
acctggctggtgaatagtgctgcccatatgtatggatatcgcccttatgacaagaccatc
agcccccgagagaatattctggtttcactgggagctgtgggtgagggcttccacaactac
caccacacctttccttatgactactcagccagtgagtaccgctggcacatcaactttacc
acgttcttcattgattgcatggctgccatcggtctggcttatgaccggaagaaagtatcc
aaggctgccatcttggccaggatgaaaagaactggagaggaaagctacaagagtggctga

DBGET integrated database retrieval system