KEGG   Bubalus bubalis (water buffalo): 102401528
Entry
102401528         CDS       T05912                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand precursor
  KO
K05461  KIT ligand
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04640  Hematopoietic cell lineage
bbub04916  Melanogenesis
bbub05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102401528 (KITLG)
   04014 Ras signaling pathway
    102401528 (KITLG)
   04015 Rap1 signaling pathway
    102401528 (KITLG)
   04072 Phospholipase D signaling pathway
    102401528 (KITLG)
   04151 PI3K-Akt signaling pathway
    102401528 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102401528 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102401528 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401528 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102401528 (KITLG)
Cytokines and growth factors [BR:bbub04052]
 Growth factors
  Growth factors (RTK binding)
   102401528 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102401528
NCBI-ProteinID: NP_001306728
UniProt: A0A0F7GJB8
LinkDB
Position
4
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVHTQGICSNRVTDDVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRQFTPEKFFGIFNKSIDAFKDLEILASKMSECVISSTSSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNSIEDSSLQWAAVALPAFFSLVIGFAFGAFYWKK
KQPNLTRTVENRQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtccacactcaagggatctgcagtaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttcccaaagactatatgataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtggaacaactgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattctatc
atagacaaacttgtgaaaatagttgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacccaggcagtttactcctgagaaattc
tttggaatttttaataaatccatcgatgccttcaaggacttggagatactggcttctaaa
atgagtgaatgtgtgatttcttcaacatcaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaattccattgaagattccagcctacagtgggcagccgtagca
ttgccagcgttcttttctcttgtgatcgggtttgcttttggggccttttactggaagaag
aaacaaccaaatcttacaaggacagttgaaaacagacagattaatgaagaggataatgaa
ataagtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system