KEGG   Bubalus bubalis (water buffalo): 102401535
Entry
102401535         CDS       T05912                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04115  p53 signaling pathway
bbub04120  Ubiquitin mediated proteolysis
bbub04144  Endocytosis
bbub04151  PI3K-Akt signaling pathway
bbub04218  Cellular senescence
bbub04625  C-type lectin receptor signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05202  Transcriptional misregulation in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102401535 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102401535 (MDM2)
   04151 PI3K-Akt signaling pathway
    102401535 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102401535 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    102401535 (MDM2)
   04115 p53 signaling pathway
    102401535 (MDM2)
   04218 Cellular senescence
    102401535 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102401535 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102401535 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102401535 (MDM2)
   05202 Transcriptional misregulation in cancer
    102401535 (MDM2)
   05206 MicroRNAs in cancer
    102401535 (MDM2)
   05205 Proteoglycans in cancer
    102401535 (MDM2)
   05203 Viral carcinogenesis
    102401535 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    102401535 (MDM2)
   05220 Chronic myeloid leukemia
    102401535 (MDM2)
   05218 Melanoma
    102401535 (MDM2)
   05219 Bladder cancer
    102401535 (MDM2)
   05215 Prostate cancer
    102401535 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102401535 (MDM2)
   05169 Epstein-Barr virus infection
    102401535 (MDM2)
   05165 Human papillomavirus infection
    102401535 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102401535 (MDM2)
   01522 Endocrine resistance
    102401535 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102401535 (MDM2)
   04121 Ubiquitin system [BR:bbub04121]
    102401535 (MDM2)
Enzymes [BR:bbub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102401535 (MDM2)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102401535 (MDM2)
Ubiquitin system [BR:bbub04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102401535 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 102401535
NCBI-ProteinID: XP_006043019
LinkDB
Position
4
AA seq 491 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVSQQEPSDSGT
SMSENRCHLEGGSNQKDLVQELQEEKPSSSDMVSRPSTSSRRRAVSETEENSDELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKDKGNMSEKAKLGDSMQEDEGFDVP
DCKKSTVSDSRESCVEENDDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQ
DKEESMESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttgaagtct
gttggtgcacagaaggacacttatactatgaaagaggttatattttatcttggccagtat
atcatgactaaacgattatatgatgaaaaacaacaacatattgtgtattgttcaaatgat
cttctaggagatttgtttggagtcccaagcttctctgtgaaggaacacaggaaaatatat
acaatgatctacagaaatttggtagtagtcagtcagcaagaaccatcagattcaggcaca
tctatgagtgaaaacaggtgtcaccttgaaggtgggagtaatcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatatggtttctagaccatctacctcatct
agaaggagagcagttagtgagacagaagaaaattcagatgaattacctggtgaacgacag
agaaagcgccacaaatctgataatatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatcaacaggaactccatca
aatccggatctggatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctcttgattcagaagattatagc
ctcagcgaagaaggacaagaactctcggatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggcgagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcatgcagtgaaatgaatcctcccctcccacctcactgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaaggaaaagataaagggaat
atgtctgagaaagccaaactaggagactcgatgcaagaagacgagggctttgatgtccct
gactgtaagaaatctacagtcagtgattccagagaatcatgtgttgaagaaaatgatgat
aaaatcacacaagcctctctatctcaagaaagtgaggactattctcagccatcgacttct
aatagcatcatttatagtagccaagaagatgtcaaagagtttgagagagaagaaacacaa
gacaaagaagaaagtatggagtctagttttccccttaatgccattgaaccttgtgtgatt
tgccagggtcgacctaaaaatggttgcattgtccatggcaaaacaggacatcttatggca
tgctttacatgtgcaaagaagttaaaaaaaaggaataagccctgtccagtatgtaggcaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system